Purity | Size | Price | VIP Price | USA Stock *0-1 Day | Global Stock *5-7 Days | Quantity | |||||
{[ item.p_purity ]} | {[ item.pr_size ]} |
{[ getRatePrice(item.pr_usd, 1,1) ]} {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate) ]} |
{[ getRatePrice(item.pr_usd, 1,1) ]} | Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate) ]} {[ getRatePrice(item.pr_usd,1,item.mem_rate) ]} | {[ item.pr_usastock ]} | Inquiry - | {[ item.pr_chinastock ]} | Inquiry - |
* Storage: {[proInfo.prStorage]}
CAS No. : | 76823-03-5 | MDL No. : | MFCD00036874 |
Formula : | C21H12O7 | Boiling Point : | - |
Linear Structure Formula : | - | InChI Key : | NJYVEMPWNAYQQN-UHFFFAOYSA-N |
M.W : | 376.32 | Pubchem ID : | 123755 |
Synonyms : |
5-Carboxyfluorescein
|
Num. heavy atoms : | 28 |
Num. arom. heavy atoms : | 18 |
Fraction Csp3 : | 0.05 |
Num. rotatable bonds : | 1 |
Num. H-bond acceptors : | 7.0 |
Num. H-bond donors : | 3.0 |
Molar Refractivity : | 95.7 |
TPSA : | 113.29 Ų |
GI absorption : | High |
BBB permeant : | No |
P-gp substrate : | No |
CYP1A2 inhibitor : | No |
CYP2C19 inhibitor : | No |
CYP2C9 inhibitor : | Yes |
CYP2D6 inhibitor : | No |
CYP3A4 inhibitor : | No |
Log Kp (skin permeation) : | -6.5 cm/s |
Log Po/w (iLOGP) : | 1.68 |
Log Po/w (XLOGP3) : | 2.95 |
Log Po/w (WLOGP) : | 3.26 |
Log Po/w (MLOGP) : | 2.37 |
Log Po/w (SILICOS-IT) : | 2.8 |
Consensus Log Po/w : | 2.61 |
Lipinski : | 0.0 |
Ghose : | None |
Veber : | 0.0 |
Egan : | 0.0 |
Muegge : | 0.0 |
Bioavailability Score : | 0.56 |
Log S (ESOL) : | -4.44 |
Solubility : | 0.0136 mg/ml ; 0.0000362 mol/l |
Class : | Moderately soluble |
Log S (Ali) : | -4.99 |
Solubility : | 0.00384 mg/ml ; 0.0000102 mol/l |
Class : | Moderately soluble |
Log S (SILICOS-IT) : | -5.5 |
Solubility : | 0.00119 mg/ml ; 0.00000317 mol/l |
Class : | Moderately soluble |
PAINS : | 0.0 alert |
Brenk : | 0.0 alert |
Leadlikeness : | 1.0 |
Synthetic accessibility : | 4.05 |
Signal Word: | Warning | Class: | N/A |
Precautionary Statements: | P305+P351+P338 | UN#: | N/A |
Hazard Statements: | H319 | Packing Group: | N/A |
GHS Pictogram: |
* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
fluorescein and derivatives:5-carboxyfluorescein (FAM)5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF)2'7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein (JOE)fluoresceinfluorescein isothiocyanate | ||
The preferred fluorochromes for use in the fluorochrome-protein conjugates are selected from the group consisting of...fluorescein-5-isothiocyanate,fluorescein-6-isothiocyanate,5-carboxyfluorescein, succinimidyl ester,6-carboxyfluorescein, succinimidyl ester,... | ||
fluorescein and derivatives:5-carboxyfluorescein (FAM)5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF)2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein (JOE)fluoresceinfluorescein isothiocyanate (FITC)hexachloro-6-carboxyfluorescein (HEX) |
fluorescein and derivatives:5-carboxyfluorescein (FAM)5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF)2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein (JOE)fluoresceinfluorescein isothiocyanate (FITC)hexachloro-6-carboxyfluorescein (HEX) | ||
fluorescein and derivatives: 5-carboxyfluorescein (FAM)5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF)2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein (JOE)fluoresceinfluorescein isothiocyanate (FITC)hexachloro-6-carboxyfluorescein (HEX) |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
With ammonia; In methanol; dichloromethane; | EXAMPLE 16 Preparation of a Product Containing Fluorescein with a Starburst Polymer A sample of 5-carboxyfluorescein (0.996 g) and starburst polyethyleneimine (Gen=2.0; amine terminated, initiated off NH3) (0.202 g) were mixed in 10 ml of methylene chloride and 5 ml of methanol and allowed to reflux for 10 minutes. Upon filtering, an insoluble red powder (0.37 g) was obtained (mostly unreacted 5-carboxy fluorescein). | |
With ammonia; In methanol; dichloromethane; | Example 16 Preparation of a product containing fluorescein with a starburst polymer A sample of 5-carboxyfluorescein (0.996 g) and starburst polyethyleneimine (Gen=2.0; amine terminated, initiated off NH3) (0.202 g) were mixed in 10 ml of methylene chloride and 5 ml of methanol and allowed to reflux for 10 minutes. Upon filtering, an insoluble red powder (0.37 g) was obtained (mostly unreacted 5-carboxy fluorescein). |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
With ammonia; In methanol; dichloromethane; | Example 16 Preparation of a Product Containing Fluorescein with a STARBURST.(TM). Polymer A sample of 5-carboxyfluorescein (0.996 g) and STARBURST.(TM). polyethyleneimine (Gen=2.0; amine terminated, initiated off NH3) (0.202 g) were mixed in 10 mL of methylene chloride and 5 mL of methanol and allowed to reflux for 10 minutes. Upon filtering, an insoluble red powder (0.37 g) was obtained (mostly unreacted 5-carboxy fluorescein). |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
In N,N-dimethyl-formamide; | Step 5: Preparation of 2-(6-hydroxy-3-oxo-3H-xanthen-9-yl)-5-(2-(3-((2-phenylpyrimidine-5-carboxamido)methyl)phenylsulfonamido)ethylcarbamoyl)benzoic acid (Compound 20) To a mixture consisting of N-(3-(N-(2-aminoethyl)sulfamoyl)benzyl)-2-phenylpyrimidine-5-carboxamide (Compound 19, 8.7 mg) in N,N-dimethylformamide (1 mL) was added 250 mM potassium phosphate buffer, pH 8 (2 mL) and 5-carboxyfluorescein, succinimidyl ester (5-FAM, SE; Biotium Catalog No. 90029; 10 mg). The mixture was stirred in the dark until the reaction was complete. The crude product was purified by preparative thin-layer chromatography (75:15:2 chloroform-methanol-water) to afford the title compound (approximately 4 mg); MS (ESI-) m/z 768 (M-1). |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
With O-(1H-benzotriazol-1-yl)-N,N,N',N'-tetramethyluronium hexafluorophosphate; N-ethyl-N,N-diisopropylamine; In N,N-dimethyl-formamide; | Compound 10 was prepared by standard techniques of solid-phase Fmoc peptide synthesis using 0.2 mmol Fmoc-Phe-Wang resin. Coupling of Fmoc-L-propargylglycine was performed as reported elsewhere. Punna et al., Angew. Chem. Int. Ed. 44: 2005 in press. Conjugation of fluorescein to the N-terminus of the peptide chain was accomplished by addition of a DMF/iPr2NEt (2:1 v/v) solution containing <strong>[76823-03-5]5(6)-carboxyfluorescein</strong> (414 mg, 1.1 mmol) and HBTU (417 mg, 1.1 mmol) to the drained resin. The mixture was agitated overnight and purified by reverse phase HPLC after cleavage from the resin. MALDI-TOF: [M+H]+ = 1579. Peptide 11 was obtained from the analogous procedure using 0.1 mmol Fmoc-Lys(Boc)-Wang resin. MALDI-TOF: [M+H]+ = 1571, [M+Na]+ = 1593. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
Wang resin (100-200 mesh) was reacted with 1-1?-carbonyl-di-imidizole (10 equiv) in 5mL DMF. This solution was mixed by rotation for 12 hours on a LabQuakeTM rotator. The reaction vessel was then evacuated by vacuum and washed three times each with THF, DCM, and DMF. Propane diamine (10 equiv) was then added in 5mL DMF and the mixture was rotated another 12 hours. Presence of the amine was verified by ninhydrin staining. FMOC-Gly (5 equiv) and HBTU (4 equiv) were added and allowed to rotate 1 hour in 5mL DMF. DIPEA (1.6 equiv) was then added and the mixture was rotated another 4 hours. This solution was removed and beads were washed as previously described and deprotected with 20percent piperidine / DMF. Following washing of beads, fluorophore was coupled through the addition of <strong>[76823-03-5]5(6)-carboxyfluorescein</strong> (1.2 equiv), HBTU (1.2 equiv) and DIPEA (1.2 equiv) in 5mL DMF and rotation for 12 hours. The resin was then washed 5 times with THF, DMF, and DCM and the resin was cleaved via addition of 50percent TFA and 1percent TES in DCM, followed by mixing by rotation for 1 hour. The solution was filtered into a glass vial and the TFA was removed under vacuum. Compound 1 was then precipitated by addition of cold diethyl ether and pelleted by centrifugation. The pellet was washed with diethyl ether, and dried via lyophilization. The structure of 1 was verified by high-resolution mass spectrometry (Figure S1) |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
With (benzotriazo-1-yloxy)tris(dimethylamino)phosphonium hexafluorophosphate; triethylamine; In tetrahydrofuran; at 20℃; for 22h; | General procedure: To a solution of 12w in THF at room temperature was added 13w, BOP and triethylamine. The reaction was stirred at room temperature for 22 h. The mixture was then filtered through Celite. The filtrate was concentrated under reduced pressure. The crude residue was purified by prep-HPLC to give 14w. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
A solution of the {2-[2-(Fmoc-amino)ethoxy]ethoxy}acetic acid (3 eq per amine) and Oxyma (3 eq per amine) in DMF (1 M) was stirred for 10 min. DIC (3 eq per amine) was then added and the resulting solution was stirred for further 5 min. The solution was then added to the appropriate resin 14/15 (1 eq), pre-swollen in DCM (10 ml), and the reaction mixture was shaken for 1 h. The solution was drained and the resin was washed with DMF (3×20 ml), DCM (3×20 ml) and MeOH (3×20 ml). The coupling reactions were monitored by a quantitative ninhydrin test23. [0117] TFA Cleavage and Purification of Reporters IQR1-IQR3 [0118] The appropriate resin (50 mg), pre-swollen in DCM, and treated with a cleavage cocktail of TFA/DCM/TIS (95/5/5, 500 mul) for 2.5 h. The solution was drained and the resin was washed with the cleavage cocktail and the solution was removed in vacuo The crude material was dissolved in a minimum amount of cleavage cocktail (300 mul) and added to ice-cold ether (7.5 ml). The precipitated solid was collected by centrifugation and the solvent removed by decantation and the precipitate was washed with cold ether (3×5 ml). The precipitate was then purified by reverse phase preparative HPLC and the required fractions were pooled and lyophilized to afford IQR1-IQR3; Reporter IQR1: HPLC: tR=4.3 min, purity>98percent by ELSD; MALDI: C77H63N5O22: [M+] calcd: 1410.34, [M+2]+ found: 1412.38; Reporter IQR1.2: HPLC tR=8.2 min, purity>98percent by ELSD; Reporter IQR1.3: HPLC tR=2.67 min purity>98percent by ELSD; Reporter IQR2: HPLC tR=3.55 min; HRMS (ESI)+ m/z: Calcd for C173H135N11O49 ([M+4H]/4)+788.9692, Found 788.9799; IR (neat) v (cm?1): 1590.1, 1454.4, 1175.2, 1113.6, 852.6, 720.5; Reporter IQR2.2: HPLC tR=5.17 min purity>98percent by ELSD; Reporter IQR2.3: HPLC tR=3.66 min purity>98percent by ELSD; Reporter IQR3: HPLC tR=4.01 min; MALDI: [M+H]+ 1741.36; HRMS (ESI)+ m/z: Calcd for C101H117N11O16 ([M+3H]/3)+ 581.2977, Found 581.3067; IR (neat) v (cm?1): 1588.8, 1414.8, 1337.3, 1178.3, 1131.9, 683.5. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
65% | With N-ethyl-N,N-diisopropylamine; N-[(dimethylamino)-3-oxo-1H-1,2,3-triazolo[4,5-b]pyridin-1-yl-methylene]-N-methylmethanaminium hexafluorophosphate; In N,N-dimethyl-formamide; at 20℃;Inert atmosphere; | To a stirred solution of 5-carboxyfluorescein (80 mg, 0.21 mmol) in dry DMF (4 ml) was added HATU (121 mg, 0.32 mmol), H-(PEG)3-OtBu (87 mg, 0.32 mmol), DIEA (110 mul, 0.63 mmol) under Ar atmosphere. The reaction was allowed to stir for overnight at room temperature and evaporated under vacuum. The residue was dissolved in 50 ml of ethyl acetate. The organic layer was washed with 5percent citric acid aq. (50 ml) and brine (50 ml). Then the organic layer was dried over MgSO4, filtered and evaporated. The crude residue was purified by column chromatography on silica gel (CHCl3 : MeOH : AcOH = 10 : 1 : 0.1) to yield compound 1-4 (88 mg, 65percent) as yellowsolid. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
48% | With benzotriazol-1-yloxyl-tris-(pyrrolidino)-phosphonium hexafluorophosphate; N-ethyl-N,N-diisopropylamine; In dichloromethane; | To the amine 5 (22 mg, 18.6 mMol), 5-carboxyfluorescein (7 mg, 0.0187 mMol) and PyBOP (10 mg, 19 mMol) in CH2C12 (1 mL) was added diisopropylethylamine (9 mg, 13 iL, 76 mMol) and the reaction stirred overnight. The volatiles were removed on the rotary evaporator and the residue purified using reverse phase chromatography, Cl 8, 5percent MeOH to 95percent MeOH in water. This gave the product 6 (10 mg, 0.0057 mMol,48percent).LCMS (ES+) 1775 (M+Naj, 1752 (M+Hj. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
47.2% | With benzotriazol-1-ol; dicyclohexyl-carbodiimide; In N,N-dimethyl-formamide; at 0 - 20℃; for 10h;Inert atmosphere; | To a stirred solution of 9a (158 mg) and 4-amino-TEMPO (86.2 mg)in dry DMF (2 mL), DCC (104 mg) and HOBt·H2O (68 mg) were addedin an ice-bath under argon atmosphere. The mixture was stirred atroom temperature for 10 h. The reaction mixture was filtered andwashed with CHCl3. After the removal of organic solvents, the residuewas purified by silica-gel column chromatography (CHCl3-MeOH =10:1) to afford 2a (65.2 mg, 47.2percent). By the similar way as 2a, 2b(14.6 mg, Y: 10.6percent) was afforded from 9b (383 mg).Data for 2a: yellow powder. Mp = 273?277 °C (dec.). IRnu (KBr)3282, 2975, 2938, 1741, 1644, 1612, 1540, 1508, 1457, 1321, 1241,1180, 1114 cm?1. 1H NMR (DMSO-d6 + hydrazobenzene, 500 MHz) delta1.09 (s, 6H, CH3 × 2), 1.11 (s, 6H, CH3 × 2), 1.53 (t, J = 12.5, 2H, CH2),1.76 (m, 2H, CH2), 4.23 (m, 1H, NCH), 6.54 (dd, J = 2.0, 8.5, 2H, ArH),6.57 (d, J = 8.5, 2H, ArH), 6.69 (d, J = 2.0, 2H, ArH), 7.35 (d, J = 8.0,1H, ArH), 8.22 (dd, J = 1.0, 8.0, 1H, ArH), 8.47 (d, J = 1.0, 1H, ArH),8.54 (d, J = 8.0, 1H, NHCO), 10.20 (brs, 2H, OH × 2). 13C NMR (DMSOd6+ hydrazobenzene, 125 MHz) delta 19.9, 32.9, 41.4, 44.8, 58.1, 83.6,102.5, 109.3, 112.9, 123.6, 124.4, 126.7, 129.3, 135.0, 136.6, 152.1,154.8, 159.9, 164.2, 168.5. Anal. Calcd for C30H29N2O7·H2O: C, 65.80;H, 5.71; N, 5.12. Found: C, 65.74; H, 5.68; N, 5.08. FABMS 530 (M+H)+.g = 2.0059. aN= 1.70 mT. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
Synthesis of Flu-C38: "NovaSyn TGR"-brand resin bearing the full-length C38 peptide with free N=terminus (WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDK; SEQ. ID. NO: 23) was prepared on a 25 mumol scale by standard Fmoc solid phase peptide synthesis methods on a Symphony Multiple Peptide Synthesizer (Protein Technologies, Inc.). Following synthesis, the resin was transferred to a fritted syringe. <strong>[76823-03-5]5-Carboxyfluorescein</strong> (28 mg, 0.075 mmol) and HOBT·H2O (11 mg, 0.075 mmol) were dissolved in N-methyl-2-pyrrolidinone (0.75 mL). Diisopropylcarbodiimide (12 muL, 0.075 mmol) was added. The resulting solution was transferred to the peptide-bearing resin. The reaction vessel was covered in foil and placed on a shaker overnight. The resin was washed with DMF (3x), and the coupling reaction was repeated with fresh reagents. The resin was then washed with DMF (3x), 20percent piperidine (2x), DMF (3x), CH2Cl2 (3x), and MeOH (3x). Fischer, R.; Mader, O.; Jung, G.; Brock, R. Bioconjugate Chem. 2003, 14, 653-660. The crude peptide was cleaved and purified as described above. Stock solutions, prepared in water, were quantified by visible absorbance (epsilon494 = 68,000 M-1 cm-1 at pH 8). MALDI-TOF-MS (monoisotopic [M+H]+, m/z): obsd. = 5089.3, calc. = 5089.3. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
General procedure: First, the TentaGel S NH2 resin (100 mg, 29 muetaiotaomicron) was 1 hour in DMF (2 mL) HOBt (5 equiv) DMF (1 mL), HBTU (5 equiv) and DIEA (10 equiv) in the presence of, processing an Fmoc-L-methionine (Fmoc-Met-OH) (5 equiv) to the beads, and at room temperature He reacted. Two hours of stirring, washing, remove the reaction common compounds. DMF (1 mL, 2 X lO min) to remove the Fmoc protecting group was treated in 20percent piperidine. Next, the under the same peptide coupling conditions, Fmoc-Lys (Alloc) -OH and Fmoc-Abu-OH was coupled. After deprotecting the Fmoc, DMF in DIEA (5 equiv), and to process the single-substituted dichloro-triazine it was reacted overnight at room temperature. Banung common Remove the compounds werewashed with DMF (3 X), MeOH (2 X), CH2C12 (2 X), and NMP (3 X). NMP (1 mL)piperazine derivative (10 equiv) of Boc protection on the inside bead and was addedDIEA (10 equiv). A common compounds 60 was overnight low at C. Afterwashing, the CH2C12 in 50percent TFA was treated 1 hour to remove any Boc. DMF (1 mL)my 10percent DIEA resins 1 sigan neutralized mixture was then washed with DMF (3 X),MeOH (2 X), CH2C12 (2 X), and NMP (3 X). Then, NMP in a bead within DIEA (5equiv)and 4,6-dichloro-l, 60 by the addition of 3,5-triazin-2-ethylamine: After overnightbanung in, DMF (3 X), MeOH (2 X ), washed with CH2C12 (2 X), and NMP (3 X). Thenafter processing the NMP within DIEA (20 equiv) and amine (20 equiv) in the resin wasbanung overnight at 60 C, DMF (3 X), MeOH (2 X), washed with CH2C12 (2 X). My Pd anhydrous CH2C12 (1 mL) (PPh3) 4 (0.2 equiv), and PhSiH3 (10 equiv) for 1hour and then deprotecting the Alloc, using peptide coupling condition, the NH2 on theresulting Lys residue 5,6-carboxyfluorescein (5 equiv) and the couple were ring. To come to cut, withrespect to the bead ACN / AcOH / H20 (5: 4: 1) treatment within 20 CNBr (40 mg / mL) and allowed tobanung at room temperature for 12 hours. The cutting crude product (crude product) was purified by HPLC. |
Yield | Reaction Conditions | Operation in experiment |
---|---|---|
Fmoc deprotection: In general, to the resin pre-swollen in DCM was added 20percent piperidine in DMF and stirred at rt (2x10 min). The solution was drained and the resin washed with DMF (3x10 mL), DCM (3x10 mL) and MeOH (3x10 mL). In the cases were Fmoc 38 SUBSTITUTE SHEET RULE 26 deprotection was done in Cy5 containing peptides, a solution of 2percent DBU in DMF (2 x 10 min, rt) was used instead. Aminoacid coupling: A solution of the appropriate D- or L-amino acid (3.0 eq per amine) and Oxyma (3.0 eq) in DMF (0.1 M) was stirred for 10 min. DIC (3.0 eq) was added and stirred for 1 min. The pre-activated mixture was then added to the resin pre-swollen in DCM and the reaction heated at 50°C for 30 min. The solution was drained and washed with DMF (3x10 ml_), DCM (3x10 ml_) and MeOH (3x10 ml_). The completion of the coupling and deprotection reactions was monitored by Kaiser test or Chloranil test when secondary amines are involved. The side chain protecting group used was Boc for arginine, tryptophan and lysine. Fmoc-Lys(Dde)-OH was used as orthogonal reagent to introduce the dyes. Coupling of other carboxylic acids: Coupling of {2-[2-(Fmoc-amino)ethoxy]ethoxy}acetic acid (PEG), <strong>[76823-03-5]5-Carboxyfluorescein</strong> (FAM), Fmoc-Lys(N3)-OH and MethylRed-Lys-(4- pentynoyl)-OH was done following the same procedure described for Aminoacid coupling. Dde deprotection: (a) Dde deprotection in non-containing Fmoc peptides was done following the next procedure: to the resin pre-swollen in DCM was added 2percent hydrazine in DMF and stirred at rt (5x10 min). The solution was drained and the resin washed with DMF (3x10 ml_), DCM (3x10 ml_) and MeOH (3x10 ml_). (b) Selective Dde deprotection in Fmoc- protected peptides was done with a solution containing Imidazole (1.35 mmol) and Hydroxylamine hydrochloride (1.80 mmol) in NMP (5 ml_). [Diaz-Mochon, J. J.; Bialy, L; Bradley, M. Org Lett 2004, 6 (7), 1127-1 129]. After complete dissolution 5 volumes of this solution were diluted with 1 volume of CH2CI2 and the resin was treated with the final mixture for 3h at room temperature. The solution was drained and the resin washed with DMF (3x10 ml_), DCM (3x10 ml_) and MeOH (3x10 ml_). |
Tags: 76823-03-5 synthesis path| 76823-03-5 SDS| 76823-03-5 COA| 76823-03-5 purity| 76823-03-5 application| 76823-03-5 NMR| 76823-03-5 COA| 76823-03-5 structure
Precautionary Statements-General | |
Code | Phrase |
P101 | If medical advice is needed,have product container or label at hand. |
P102 | Keep out of reach of children. |
P103 | Read label before use |
Prevention | |
Code | Phrase |
P201 | Obtain special instructions before use. |
P202 | Do not handle until all safety precautions have been read and understood. |
P210 | Keep away from heat/sparks/open flames/hot surfaces. - No smoking. |
P211 | Do not spray on an open flame or other ignition source. |
P220 | Keep/Store away from clothing/combustible materials. |
P221 | Take any precaution to avoid mixing with combustibles |
P222 | Do not allow contact with air. |
P223 | Keep away from any possible contact with water, because of violent reaction and possible flash fire. |
P230 | Keep wetted |
P231 | Handle under inert gas. |
P232 | Protect from moisture. |
P233 | Keep container tightly closed. |
P234 | Keep only in original container. |
P235 | Keep cool |
P240 | Ground/bond container and receiving equipment. |
P241 | Use explosion-proof electrical/ventilating/lighting/equipment. |
P242 | Use only non-sparking tools. |
P243 | Take precautionary measures against static discharge. |
P244 | Keep reduction valves free from grease and oil. |
P250 | Do not subject to grinding/shock/friction. |
P251 | Pressurized container: Do not pierce or burn, even after use. |
P260 | Do not breathe dust/fume/gas/mist/vapours/spray. |
P261 | Avoid breathing dust/fume/gas/mist/vapours/spray. |
P262 | Do not get in eyes, on skin, or on clothing. |
P263 | Avoid contact during pregnancy/while nursing. |
P264 | Wash hands thoroughly after handling. |
P265 | Wash skin thouroughly after handling. |
P270 | Do not eat, drink or smoke when using this product. |
P271 | Use only outdoors or in a well-ventilated area. |
P272 | Contaminated work clothing should not be allowed out of the workplace. |
P273 | Avoid release to the environment. |
P280 | Wear protective gloves/protective clothing/eye protection/face protection. |
P281 | Use personal protective equipment as required. |
P282 | Wear cold insulating gloves/face shield/eye protection. |
P283 | Wear fire/flame resistant/retardant clothing. |
P284 | Wear respiratory protection. |
P285 | In case of inadequate ventilation wear respiratory protection. |
P231 + P232 | Handle under inert gas. Protect from moisture. |
P235 + P410 | Keep cool. Protect from sunlight. |
Response | |
Code | Phrase |
P301 | IF SWALLOWED: |
P304 | IF INHALED: |
P305 | IF IN EYES: |
P306 | IF ON CLOTHING: |
P307 | IF exposed: |
P308 | IF exposed or concerned: |
P309 | IF exposed or if you feel unwell: |
P310 | Immediately call a POISON CENTER or doctor/physician. |
P311 | Call a POISON CENTER or doctor/physician. |
P312 | Call a POISON CENTER or doctor/physician if you feel unwell. |
P313 | Get medical advice/attention. |
P314 | Get medical advice/attention if you feel unwell. |
P315 | Get immediate medical advice/attention. |
P320 | |
P302 + P352 | IF ON SKIN: wash with plenty of soap and water. |
P321 | |
P322 | |
P330 | Rinse mouth. |
P331 | Do NOT induce vomiting. |
P332 | IF SKIN irritation occurs: |
P333 | If skin irritation or rash occurs: |
P334 | Immerse in cool water/wrap n wet bandages. |
P335 | Brush off loose particles from skin. |
P336 | Thaw frosted parts with lukewarm water. Do not rub affected area. |
P337 | If eye irritation persists: |
P338 | Remove contact lenses, if present and easy to do. Continue rinsing. |
P340 | Remove victim to fresh air and keep at rest in a position comfortable for breathing. |
P341 | If breathing is difficult, remove victim to fresh air and keep at rest in a position comfortable for breathing. |
P342 | If experiencing respiratory symptoms: |
P350 | Gently wash with plenty of soap and water. |
P351 | Rinse cautiously with water for several minutes. |
P352 | Wash with plenty of soap and water. |
P353 | Rinse skin with water/shower. |
P360 | Rinse immediately contaminated clothing and skin with plenty of water before removing clothes. |
P361 | Remove/Take off immediately all contaminated clothing. |
P362 | Take off contaminated clothing and wash before reuse. |
P363 | Wash contaminated clothing before reuse. |
P370 | In case of fire: |
P371 | In case of major fire and large quantities: |
P372 | Explosion risk in case of fire. |
P373 | DO NOT fight fire when fire reaches explosives. |
P374 | Fight fire with normal precautions from a reasonable distance. |
P376 | Stop leak if safe to do so. Oxidising gases (section 2.4) 1 |
P377 | Leaking gas fire: Do not extinguish, unless leak can be stopped safely. |
P378 | |
P380 | Evacuate area. |
P381 | Eliminate all ignition sources if safe to do so. |
P390 | Absorb spillage to prevent material damage. |
P391 | Collect spillage. Hazardous to the aquatic environment |
P301 + P310 | IF SWALLOWED: Immediately call a POISON CENTER or doctor/physician. |
P301 + P312 | IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell. |
P301 + P330 + P331 | IF SWALLOWED: Rinse mouth. Do NOT induce vomiting. |
P302 + P334 | IF ON SKIN: Immerse in cool water/wrap in wet bandages. |
P302 + P350 | IF ON SKIN: Gently wash with plenty of soap and water. |
P303 + P361 + P353 | IF ON SKIN (or hair): Remove/Take off Immediately all contaminated clothing. Rinse SKIN with water/shower. |
P304 + P312 | IF INHALED: Call a POISON CENTER or doctor/physician if you feel unwell. |
P304 + P340 | IF INHALED: Remove victim to fresh air and Keep at rest in a position comfortable for breathing. |
P304 + P341 | IF INHALED: If breathing is difficult, remove victim to fresh air and keep at rest in a position comfortable for breathing. |
P305 + P351 + P338 | IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing. |
P306 + P360 | IF ON CLOTHING: Rinse Immediately contaminated CLOTHING and SKIN with plenty of water before removing clothes. |
P307 + P311 | IF exposed: call a POISON CENTER or doctor/physician. |
P308 + P313 | IF exposed or concerned: Get medical advice/attention. |
P309 + P311 | IF exposed or if you feel unwell: call a POISON CENTER or doctor/physician. |
P332 + P313 | IF SKIN irritation occurs: Get medical advice/attention. |
P333 + P313 | IF SKIN irritation or rash occurs: Get medical advice/attention. |
P335 + P334 | Brush off loose particles from skin. Immerse in cool water/wrap in wet bandages. |
P337 + P313 | IF eye irritation persists: Get medical advice/attention. |
P342 + P311 | IF experiencing respiratory symptoms: call a POISON CENTER or doctor/physician. |
P370 + P376 | In case of fire: Stop leak if safe to Do so. |
P370 + P378 | In case of fire: |
P370 + P380 | In case of fire: Evacuate area. |
P370 + P380 + P375 | In case of fire: Evacuate area. Fight fire remotely due to the risk of explosion. |
P371 + P380 + P375 | In case of major fire and large quantities: Evacuate area. Fight fire remotely due to the risk of explosion. |
Storage | |
Code | Phrase |
P401 | |
P402 | Store in a dry place. |
P403 | Store in a well-ventilated place. |
P404 | Store in a closed container. |
P405 | Store locked up. |
P406 | Store in corrosive resistant/ container with a resistant inner liner. |
P407 | Maintain air gap between stacks/pallets. |
P410 | Protect from sunlight. |
P411 | |
P412 | Do not expose to temperatures exceeding 50 oC/ 122 oF. |
P413 | |
P420 | Store away from other materials. |
P422 | |
P402 + P404 | Store in a dry place. Store in a closed container. |
P403 + P233 | Store in a well-ventilated place. Keep container tightly closed. |
P403 + P235 | Store in a well-ventilated place. Keep cool. |
P410 + P403 | Protect from sunlight. Store in a well-ventilated place. |
P410 + P412 | Protect from sunlight. Do not expose to temperatures exceeding 50 oC/122oF. |
P411 + P235 | Keep cool. |
Disposal | |
Code | Phrase |
P501 | Dispose of contents/container to ... |
P502 | Refer to manufacturer/supplier for information on recovery/recycling |
Physical hazards | |
Code | Phrase |
H200 | Unstable explosive |
H201 | Explosive; mass explosion hazard |
H202 | Explosive; severe projection hazard |
H203 | Explosive; fire, blast or projection hazard |
H204 | Fire or projection hazard |
H205 | May mass explode in fire |
H220 | Extremely flammable gas |
H221 | Flammable gas |
H222 | Extremely flammable aerosol |
H223 | Flammable aerosol |
H224 | Extremely flammable liquid and vapour |
H225 | Highly flammable liquid and vapour |
H226 | Flammable liquid and vapour |
H227 | Combustible liquid |
H228 | Flammable solid |
H229 | Pressurized container: may burst if heated |
H230 | May react explosively even in the absence of air |
H231 | May react explosively even in the absence of air at elevated pressure and/or temperature |
H240 | Heating may cause an explosion |
H241 | Heating may cause a fire or explosion |
H242 | Heating may cause a fire |
H250 | Catches fire spontaneously if exposed to air |
H251 | Self-heating; may catch fire |
H252 | Self-heating in large quantities; may catch fire |
H260 | In contact with water releases flammable gases which may ignite spontaneously |
H261 | In contact with water releases flammable gas |
H270 | May cause or intensify fire; oxidizer |
H271 | May cause fire or explosion; strong oxidizer |
H272 | May intensify fire; oxidizer |
H280 | Contains gas under pressure; may explode if heated |
H281 | Contains refrigerated gas; may cause cryogenic burns or injury |
H290 | May be corrosive to metals |
Health hazards | |
Code | Phrase |
H300 | Fatal if swallowed |
H301 | Toxic if swallowed |
H302 | Harmful if swallowed |
H303 | May be harmful if swallowed |
H304 | May be fatal if swallowed and enters airways |
H305 | May be harmful if swallowed and enters airways |
H310 | Fatal in contact with skin |
H311 | Toxic in contact with skin |
H312 | Harmful in contact with skin |
H313 | May be harmful in contact with skin |
H314 | Causes severe skin burns and eye damage |
H315 | Causes skin irritation |
H316 | Causes mild skin irritation |
H317 | May cause an allergic skin reaction |
H318 | Causes serious eye damage |
H319 | Causes serious eye irritation |
H320 | Causes eye irritation |
H330 | Fatal if inhaled |
H331 | Toxic if inhaled |
H332 | Harmful if inhaled |
H333 | May be harmful if inhaled |
H334 | May cause allergy or asthma symptoms or breathing difficulties if inhaled |
H335 | May cause respiratory irritation |
H336 | May cause drowsiness or dizziness |
H340 | May cause genetic defects |
H341 | Suspected of causing genetic defects |
H350 | May cause cancer |
H351 | Suspected of causing cancer |
H360 | May damage fertility or the unborn child |
H361 | Suspected of damaging fertility or the unborn child |
H361d | Suspected of damaging the unborn child |
H362 | May cause harm to breast-fed children |
H370 | Causes damage to organs |
H371 | May cause damage to organs |
H372 | Causes damage to organs through prolonged or repeated exposure |
H373 | May cause damage to organs through prolonged or repeated exposure |
Environmental hazards | |
Code | Phrase |
H400 | Very toxic to aquatic life |
H401 | Toxic to aquatic life |
H402 | Harmful to aquatic life |
H410 | Very toxic to aquatic life with long-lasting effects |
H411 | Toxic to aquatic life with long-lasting effects |
H412 | Harmful to aquatic life with long-lasting effects |
H413 | May cause long-lasting harmful effects to aquatic life |
H420 | Harms public health and the environment by destroying ozone in the upper atmosphere |
Sorry,this product has been discontinued.
Home
* Country/Region
* Quantity Required :
* Cat. No.:
* CAS No :
* Product Name :
* Additional Information :