Select Region or Location
Americas
  • Argentina
  • Brazil
  • Canada
  • Mexico
  • United States
  • Other Americas
Europe
  • Austria
  • Belgium
  • Bulgaria
  • Croatia/Hrvatska
  • Cyprus
  • Czech Republic
  • Denmark
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hungary
  • Ireland
  • Italy
  • Latvia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Malta
  • Netherlands
  • Norway
  • Poland
  • Portugal
  • Romania
  • Slovak Republic
  • Slovenia
  • Spain
  • Sweden
  • Switzerland
  • Turkey
  • United Kingdom
  • Other Europe
Asia Pacific
  • Australia
  • China
  • India
  • Indonesia
  • Japan
  • Korea, Republic of
  • Malaysia
  • New Zealand
  • Philippines
  • Singapore
  • Thailand
  • Vietnam
  • Other Asia Pacific
Africa And Middle East
  • Egypt
  • Israel
  • Other Africa And Middle East
USD
Home Cart Sign in  
Chemical Structure| 73821-95-1 Chemical Structure| 73821-95-1

Structure of Boc-Asp(OcHx)-OH
CAS No.: 73821-95-1

Chemical Structure| 73821-95-1

*Storage: {[sel_prStorage]}

*Shipping: {[sel_prShipping]}

,{[proInfo.pro_purity]}

Synonyms: (S)-2-((tert-Butoxycarbonyl)amino)-4-(cyclohexyloxy)-4-oxobutanoic acid

4.5 *For Research Use Only! Not for Human Use. We Do Not Sell to Patients.

{[proInfo.pro_purity]}
Cat. No.: {[proInfo.prAm]} Purity: {[proInfo.pro_purity]}

Change View

Size Price VIP Price

DE Stock

US Stock

Asia Stock

Global Stock

In Stock
{[ item.pr_size ]}{[ size_append_text(item.pr_size, proInfo.prAm, 'list') ]} Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]}

  • {[ item.pr_size ]}
    {[ size_append_text(item.pr_size, proInfo.prAm, 'list') ]}

In Stock

- +

Please Login or Create an Account to: See VIP prices and availability

  • 1-2 Day Shipping
  • High Quality
  • Technical Support
Product Citations

Alternative Products

Product Details of [ 73821-95-1 ]

CAS No. :73821-95-1
Formula : C15H25NO6
M.W : 315.36
SMILES Code : O=C(OC1CCCCC1)C[C@@H](C(O)=O)NC(OC(C)(C)C)=O
Synonyms :
(S)-2-((tert-Butoxycarbonyl)amino)-4-(cyclohexyloxy)-4-oxobutanoic acid
English Name :Boc-Asp(OcHx)-OH
MDL No. :MFCD00061996
InChI Key :NLPQIWFEEKQBBN-NSHDSACASA-N
Pubchem ID :7009416

Safety of [ 73821-95-1 ]

Computational Chemistry of [ 73821-95-1 ] Show Less

Physicochemical Properties

Num. heavy atoms 22
Num. arom. heavy atoms 0
Fraction Csp3 0.8
Num. rotatable bonds 9
Num. H-bond acceptors 6.0
Num. H-bond donors 2.0
Molar Refractivity 79.68
TPSA ?

Topological Polar Surface Area: Calculated from
Ertl P. et al. 2000 J. Med. Chem.

101.93 Ų

Lipophilicity

Log Po/w (iLOGP)?

iLOGP: in-house physics-based method implemented from
Daina A et al. 2014 J. Chem. Inf. Model.

2.3
Log Po/w (XLOGP3)?

XLOGP3: Atomistic and knowledge-based method calculated by
XLOGP program, version 3.2.2, courtesy of CCBG, Shanghai Institute of Organic Chemistry

2.19
Log Po/w (WLOGP)?

WLOGP: Atomistic method implemented from
Wildman SA and Crippen GM. 1999 J. Chem. Inf. Model.

2.23
Log Po/w (MLOGP)?

MLOGP: Topological method implemented from
Moriguchi I. et al. 1992 Chem. Pharm. Bull.
Moriguchi I. et al. 1994 Chem. Pharm. Bull.
Lipinski PA. et al. 2001 Adv. Drug. Deliv. Rev.

1.2
Log Po/w (SILICOS-IT)?

SILICOS-IT: Hybrid fragmental/topological method calculated by
FILTER-IT program, version 1.0.2, courtesy of SILICOS-IT, http://www.silicos-it.com

1.28
Consensus Log Po/w?

Consensus Log Po/w: Average of all five predictions

1.84

Water Solubility

Log S (ESOL):?

ESOL: Topological method implemented from
Delaney JS. 2004 J. Chem. Inf. Model.

-2.58
Solubility 0.828 mg/ml ; 0.00262 mol/l
Class?

Solubility class: Log S scale
Insoluble < -10 < Poorly < -6 < Moderately < -4 < Soluble < -2 Very < 0 < Highly

Soluble
Log S (Ali)?

Ali: Topological method implemented from
Ali J. et al. 2012 J. Chem. Inf. Model.

-3.96
Solubility 0.0342 mg/ml ; 0.000109 mol/l
Class?

Solubility class: Log S scale
Insoluble < -10 < Poorly < -6 < Moderately < -4 < Soluble < -2 Very < 0 < Highly

Soluble
Log S (SILICOS-IT)?

SILICOS-IT: Fragmental method calculated by
FILTER-IT program, version 1.0.2, courtesy of SILICOS-IT, http://www.silicos-it.com

-1.77
Solubility 5.41 mg/ml ; 0.0171 mol/l
Class?

Solubility class: Log S scale
Insoluble < -10 < Poorly < -6 < Moderately < -4 < Soluble < -2 Very < 0 < Highly

Soluble

Pharmacokinetics

GI absorption?

Gatrointestinal absorption: according to the white of the BOILED-Egg

High
BBB permeant?

BBB permeation: according to the yolk of the BOILED-Egg

No
P-gp substrate?

P-glycoprotein substrate: SVM model built on 1033 molecules (training set)
and tested on 415 molecules (test set)
10-fold CV: ACC=0.72 / AUC=0.77
External: ACC=0.88 / AUC=0.94

Yes
CYP1A2 inhibitor?

Cytochrome P450 1A2 inhibitor: SVM model built on 9145 molecules (training set)
and tested on 3000 molecules (test set)
10-fold CV: ACC=0.83 / AUC=0.90
External: ACC=0.84 / AUC=0.91

No
CYP2C19 inhibitor?

Cytochrome P450 2C19 inhibitor: SVM model built on 9272 molecules (training set)
and tested on 3000 molecules (test set)
10-fold CV: ACC=0.80 / AUC=0.86
External: ACC=0.80 / AUC=0.87

No
CYP2C9 inhibitor?

Cytochrome P450 2C9 inhibitor: SVM model built on 5940 molecules (training set)
and tested on 2075 molecules (test set)
10-fold CV: ACC=0.78 / AUC=0.85
External: ACC=0.71 / AUC=0.81

No
CYP2D6 inhibitor?

Cytochrome P450 2D6 inhibitor: SVM model built on 3664 molecules (training set)
and tested on 1068 molecules (test set)
10-fold CV: ACC=0.79 / AUC=0.85
External: ACC=0.81 / AUC=0.87

No
CYP3A4 inhibitor?

Cytochrome P450 3A4 inhibitor: SVM model built on 7518 molecules (training set)
and tested on 2579 molecules (test set)
10-fold CV: ACC=0.77 / AUC=0.85
External: ACC=0.78 / AUC=0.86

No
Log Kp (skin permeation)?

Skin permeation: QSPR model implemented from
Potts RO and Guy RH. 1992 Pharm. Res.

-6.67 cm/s

Druglikeness

Lipinski?

Lipinski (Pfizer) filter: implemented from
Lipinski CA. et al. 2001 Adv. Drug Deliv. Rev.
MW ≤ 500
MLOGP ≤ 4.15
N or O ≤ 10
NH or OH ≤ 5

0.0
Ghose?

Ghose filter: implemented from
Ghose AK. et al. 1999 J. Comb. Chem.
160 ≤ MW ≤ 480
-0.4 ≤ WLOGP ≤ 5.6
40 ≤ MR ≤ 130
20 ≤ atoms ≤ 70

None
Veber?

Veber (GSK) filter: implemented from
Veber DF. et al. 2002 J. Med. Chem.
Rotatable bonds ≤ 10
TPSA ≤ 140

0.0
Egan?

Egan (Pharmacia) filter: implemented from
Egan WJ. et al. 2000 J. Med. Chem.
WLOGP ≤ 5.88
TPSA ≤ 131.6

0.0
Muegge?

Muegge (Bayer) filter: implemented from
Muegge I. et al. 2001 J. Med. Chem.
200 ≤ MW ≤ 600
-2 ≤ XLOGP ≤ 5
TPSA ≤ 150
Num. rings ≤ 7
Num. carbon > 4
Num. heteroatoms > 1
Num. rotatable bonds ≤ 15
H-bond acc. ≤ 10
H-bond don. ≤ 5

0.0
Bioavailability Score?

Abbott Bioavailability Score: Probability of F > 10% in rat
implemented from
Martin YC. 2005 J. Med. Chem.

0.56

Medicinal Chemistry

PAINS?

Pan Assay Interference Structures: implemented from
Baell JB. & Holloway GA. 2010 J. Med. Chem.

0.0 alert
Brenk?

Structural Alert: implemented from
Brenk R. et al. 2008 ChemMedChem

1.0 alert: heavy_metal
Leadlikeness?

Leadlikeness: implemented from
Teague SJ. 1999 Angew. Chem. Int. Ed.
250 ≤ MW ≤ 350
XLOGP ≤ 3.5
Num. rotatable bonds ≤ 7

No; 1 violation:MW<1.0
Synthetic accessibility?

Synthetic accessibility score: from 1 (very easy) to 10 (very difficult)
based on 1024 fragmental contributions (FP2) modulated by size and complexity penaties,
trained on 12'782'590 molecules and tested on 40 external molecules (r2 = 0.94)

3.62

Application In Synthesis of [ 73821-95-1 ]

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

  • Downstream synthetic route of [ 73821-95-1 ]

[ 73821-95-1 ] Synthesis Path-Downstream   1~10

  • 1
  • [ 24424-99-5 ]
  • [ 112259-66-2 ]
  • [ 73821-95-1 ]
YieldReaction ConditionsOperation in experiment
85% With triethylamine In N,N-dimethyl-formamide for 12h; Ambient temperature;
  • 2
  • [ 73821-95-1 ]
  • [ 112259-66-2 ]
YieldReaction ConditionsOperation in experiment
With trifluoroacetic acid In dichloromethane for 0.75h; Ambient temperature;
With trifluoroacetic acid for 0.333333h;
With trifluoroacetic acid at 20℃; for 0.25h; α-Hydroxy carboxylic acids General procedure: The Boc-protected amino acid (1 mmol) was treated with TFA (3 mL) for 15 minutes. Afterevaporation the residue was dissolved in dioxane-water (1:1, 4 mL) and the flask wasplaced in an ice bath. tert-Butylnitrite (0.13 mL, 1.1 mmol) was added and stirring wasmaintained under nitrogen at room temperature for one hour. After pouring the reactionmixture onto celite and evaporation (50 Pa, 30 °C) into a dry free-floating powder,separation was performed utilizing a CombiFlash Rf (Teledyne ISCO) automated flashchromatography apparatus by means of AcOH-MeOH-EtOAc (1:9:90) on a normal phasesilica column affording the pure a-hydroxy carboxylic acid in the yield specified in Table 1.HO-His(Bom)-OH and HO-Arg(Tos)-OH were isolated by adding water (30 mL) to thereaction mixture followed by freeze drying and HPLC purification.
  • 3
  • [ 13734-34-4 ]
  • [ 73821-95-1 ]
  • [ 47355-10-2 ]
  • [ 117903-25-0 ]
  • BocGlyOH, BocNleOH, BocTyr(OdiClBzl)OH [ No CAS ]
  • [ 141611-96-3 ]
  • 4
  • [ 37553-65-4 ]
  • [ 73821-95-1 ]
  • [ 6404-28-0 ]
  • [ 47355-10-2 ]
  • BocGlyOH, BocTyr(OdiClBzl)OH [ No CAS ]
  • [ 141611-94-1 ]
  • 5
  • [ 13734-34-4 ]
  • [ 73821-95-1 ]
  • [ 6404-28-0 ]
  • [ 47355-10-2 ]
  • BocSarOH, BocTyr(OdiClBzl)OH [ No CAS ]
  • [ 141611-98-5 ]
  • 6
  • [ 13734-34-4 ]
  • [ 73821-95-1 ]
  • [ 6404-28-0 ]
  • [ 47355-10-2 ]
  • BocProOH, Boc(N-Me)Tyr(OdiClBzl)OH [ No CAS ]
  • [ 141612-00-2 ]
  • 7
  • [ 13734-34-4 ]
  • [ 73821-95-1 ]
  • [ 6404-28-0 ]
  • [ 47355-10-2 ]
  • BocProOH, BocTyr(OdiClBzl)OH [ No CAS ]
  • [ 141611-99-6 ]
  • 8
  • [ 23680-31-1 ]
  • [ 73821-95-1 ]
  • [ 207857-15-6 ]
  • [ 150828-96-9 ]
  • [ 91037-75-1 ]
YieldReaction ConditionsOperation in experiment
Yield given; Multistep reaction;
  • 9
  • [ 15761-39-4 ]
  • [ 13139-15-6 ]
  • [ 15761-38-3 ]
  • [ 13836-37-8 ]
  • [ 23680-31-1 ]
  • [ 73821-95-1 ]
  • [ 54613-99-9 ]
  • [ 47689-67-8 ]
  • [ 47355-10-2 ]
  • [ 83468-83-1 ]
  • [ 65420-40-8 ]
  • HSQGTFTSDYSKYLDSRRAQDFVQWLMNGGPSSGAPPPS-NH2 [ No CAS ]
  • 10
  • [ 13139-15-6 ]
  • [ 15761-38-3 ]
  • [ 2488-15-5 ]
  • [ 15260-10-3 ]
  • [ 23680-31-1 ]
  • [ 73821-95-1 ]
  • [ 73821-97-3 ]
  • [ 54613-99-9 ]
  • [ 47355-10-2 ]
  • [ 83468-83-1 ]
  • [ 65420-40-8 ]
  • HSQGTFTSDYSKYLDERRAKDFVQWLMNT-NH2 [ No CAS ]
 

Historical Records

Categories

Related Functional Groups of
[ 73821-95-1 ]

Amino Acid Derivatives

Chemical Structure| 1676-90-0

A148662 [1676-90-0]

Boc-Asp(OtBu)-OH

Similarity: 0.97

Chemical Structure| 155542-33-9

A170283 [155542-33-9]

Boc-D-Asp(OtBu)-OH

Similarity: 0.97

Chemical Structure| 1913-12-8

A250185 [1913-12-8]

Dicyclohexylamine (S)-4-(tert-butoxy)-2-((tert-butoxycarbonyl)amino)-4-oxobutanoate

Similarity: 0.95

Chemical Structure| 77004-75-2

A237707 [77004-75-2]

(R)-4-(tert-Butoxy)-3-((tert-butoxycarbonyl)amino)-4-oxobutanoic acid

Similarity: 0.95

Chemical Structure| 73821-97-3

A349127 [73821-97-3]

Boc-Glu(OcHex)-OH

Similarity: 0.95