Home Cart 0 Sign in  

[ CAS No. 2488-15-5 ] {[proInfo.proName]}

,{[proInfo.pro_purity]}
Cat. No.: {[proInfo.prAm]}
Chemical Structure| 2488-15-5
Chemical Structure| 2488-15-5
Structure of 2488-15-5 * Storage: {[proInfo.prStorage]}

Please Login or Create an Account to: See VIP prices and availability

Cart0 Add to My Favorites Add to My Favorites Bulk Inquiry Inquiry Add To Cart

Search after Editing

* Storage: {[proInfo.prStorage]}

* Shipping: {[proInfo.prShipping]}

Quality Control of [ 2488-15-5 ]

Related Doc. of [ 2488-15-5 ]

Alternatived Products of [ 2488-15-5 ]
Product Citations

Product Details of [ 2488-15-5 ]

CAS No. :2488-15-5 MDL No. :MFCD00065586
Formula : C10H19NO4S Boiling Point : -
Linear Structure Formula :- InChI Key :IMUSLIHRIYOHEV-ZETCQYMHSA-N
M.W : 249.33 Pubchem ID :89857
Synonyms :
Chemical Name :Boc-Met-OH

Calculated chemistry of [ 2488-15-5 ]      Expand+

Physicochemical Properties

Num. heavy atoms : 16
Num. arom. heavy atoms : 0
Fraction Csp3 : 0.8
Num. rotatable bonds : 8
Num. H-bond acceptors : 4.0
Num. H-bond donors : 2.0
Molar Refractivity : 64.06
TPSA : 100.93 Ų

Pharmacokinetics

GI absorption : High
BBB permeant : No
P-gp substrate : No
CYP1A2 inhibitor : No
CYP2C19 inhibitor : No
CYP2C9 inhibitor : No
CYP2D6 inhibitor : No
CYP3A4 inhibitor : No
Log Kp (skin permeation) : -6.71 cm/s

Lipophilicity

Log Po/w (iLOGP) : 2.03
Log Po/w (XLOGP3) : 1.56
Log Po/w (WLOGP) : 1.72
Log Po/w (MLOGP) : 1.13
Log Po/w (SILICOS-IT) : 0.82
Consensus Log Po/w : 1.45

Druglikeness

Lipinski : 0.0
Ghose : None
Veber : 0.0
Egan : 0.0
Muegge : 0.0
Bioavailability Score : 0.56

Water Solubility

Log S (ESOL) : -1.84
Solubility : 3.6 mg/ml ; 0.0144 mol/l
Class : Very soluble
Log S (Ali) : -3.29
Solubility : 0.128 mg/ml ; 0.000513 mol/l
Class : Soluble
Log S (SILICOS-IT) : -1.57
Solubility : 6.76 mg/ml ; 0.0271 mol/l
Class : Soluble

Medicinal Chemistry

PAINS : 0.0 alert
Brenk : 0.0 alert
Leadlikeness : 2.0
Synthetic accessibility : 3.15

Safety of [ 2488-15-5 ]

Signal Word:Warning Class:N/A
Precautionary Statements:P305+P351+P338 UN#:N/A
Hazard Statements:H319 Packing Group:N/A
GHS Pictogram:

Application In Synthesis of [ 2488-15-5 ]

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

  • Downstream synthetic route of [ 2488-15-5 ]

[ 2488-15-5 ] Synthesis Path-Downstream   1~14

  • 1
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly [ No CAS ]
  • [ 23446-11-9 ]
  • 2
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, 1-<3-(4-hydroxyphenyl)-1-oxopropoxy>-2,5-pyrrolidinedione [ No CAS ]
  • [ 72163-37-2 ]
  • 3
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, 1-<3-<(4-carboxymethyl)phenyl>-1-oxopropoxy>-2,5-pyrrolidinedione [ No CAS ]
  • [ 127153-35-9 ]
  • 4
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, 4-<5-(1,1-dimethylethyl)-2H-tetrazol-5-yl>benzenepropanoic acid [ No CAS ]
  • [ 127153-43-9 ]
  • 5
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, (+/-)-α-(acetylamino)-4-<2-(1,1-dimethylethyl)-2H-tetrazol-5-yl>benzenepropanoic acid [ No CAS ]
  • [ 127153-30-4 ]
  • [ 127153-31-5 ]
  • 6
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, (+/-)-α-(acetylamino)-4-<<2-(1,1-dimethylethyl)-2H-tetrazol-5-yl>methyl>benzenepropanoic acid [ No CAS ]
  • [ 127153-37-1 ]
  • [ 127153-38-2 ]
  • 7
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-Gly-OH, Boc-Tyr(2,6-Cl2-Bzl)-OH, acetic anhydride [ No CAS ]
  • [ 143618-03-5 ]
  • 8
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-β-Ala-OH, Boc-Tyr(2,6-Cl2-Bzl)-OH, acetic anhydride [ No CAS ]
  • [ 143631-74-7 ]
  • 9
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-NHCH2CH2CH2CH2COOH, Boc-Tyr(2,6-Cl2-Bzl)-OH, acetic anhydride [ No CAS ]
  • [ 143618-05-7 ]
  • 10
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-NHCH2CH2CH2COOH, Boc-Tyr(2,6-Cl2-Bzl)-OH, acetic anhydride [ No CAS ]
  • [ 143618-04-6 ]
  • 11
  • [ 2488-15-5 ]
  • [ 7536-58-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • Boc-NHCH2CH2CH2CH2CH2COOH, Boc-Tyr(2,6-Cl2-Bzl)-OH, acetic anhydride [ No CAS ]
  • [ 143618-06-8 ]
  • 12
  • [ 2488-15-5 ]
  • [ 13734-34-4 ]
  • [ 47355-10-2 ]
  • [ 131570-56-4 ]
  • t-Boc-Leu-OCH2-phenylacetamidomethyl resin, t-Boc-Asp-(β-OFm)-OH [ No CAS ]
  • (1S,4S,7S,10S,13S,16S)-7-Benzyl-10-(1H-indol-3-ylmethyl)-4-isobutyl-16-(2-methylsulfanyl-ethyl)-2,5,8,11,14,17,20-heptaaza-bicyclo[11.5.4]docosane-3,6,9,12,15,18,21-heptaone [ No CAS ]
  • 13
  • [ 4530-20-5 ]
  • [ 13139-16-7 ]
  • [ 13139-15-6 ]
  • [ 15761-38-3 ]
  • [ 2488-15-5 ]
  • [ 7536-55-2 ]
  • [ 19746-37-3 ]
  • [ 27144-18-9 ]
  • [ 13734-34-4 ]
  • [ 23680-31-1 ]
  • [ 55260-24-7 ]
  • mouse saposin C [ No CAS ]
  • 14
  • [ 13139-15-6 ]
  • [ 15761-38-3 ]
  • [ 2488-15-5 ]
  • [ 15260-10-3 ]
  • [ 23680-31-1 ]
  • [ 73821-95-1 ]
  • [ 73821-97-3 ]
  • [ 54613-99-9 ]
  • [ 47355-10-2 ]
  • [ 83468-83-1 ]
  • [ 65420-40-8 ]
  • HSQGTFTSDYSKYLDERRAKDFVQWLMNT-NH2 [ No CAS ]
Recommend Products
Same Skeleton Products
Historical Records
; ;