Structure of 660398-06-1
*Storage: {[sel_prStorage]}
*Shipping: {[sel_prShipping]}
The BI-3802 was designed by Boehringer Ingelheim and could be obtained free of charge through the Boehringer Ingelheim open innovation portal opnMe.com, associated with its negative control.
4.5
*For Research Use Only! Not for Human Use. We Do Not Sell to Patients.
Change View
| Size | Price | VIP Price |
DE Stock US Stock |
Asia Stock Global Stock |
In Stock |
| {[ item.pr_size ]}{[ size_append_text(item.pr_size, proInfo.prAm, 'list') ]} |
Inquiry
{[ getRatePrice(item.pr_usd, 1,1,item.pr_is_large_size_no_price, item.pr_usd) ]} {[ getRatePrice(item.pr_usd,item.pr_rate,1,item.pr_is_large_size_no_price, item.discount_usd) ]} {[ getRatePrice(item.pr_usd, 1,1,item.pr_is_large_size_no_price, item.pr_usd) ]} |
Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]} | {[ item.p_spot_brand_remark ]} 1-2 weeks {[ item.pr_usastock ]} In Stock Inquiry - | {[ item.p_spot_brand_remark ]} 1-2 weeks {[ item.pr_chinastock ]} {[ item.pr_remark ]} In Stock Inquiry - | Login - + |
Please Login or Create an Account to: See VIP prices and availability
Asia Stock: Ship in 3-5 business days
EU Stock: ship in 0-1 business day
Global Stock: ship in 7-10 days
US Stock: ship in 0-1 business day
Global Stock: ship in 5-7 days
{[ item.p_spot_brand_remark ]}
1-2weeks
Inquiry
Inquiry
{[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]}
{[ getRatePrice(item.pr_usd, 1,1,item.pr_is_large_size_no_price, item.pr_usd) ]}
{[ getRatePrice(item.pr_usd,1,item.mem_rate,item.pr_is_large_size_no_price, item.pr_usd) ]}
{[ item.p_spot_brand_remark ]}
1-2weeks
Inquiry
Inquiry
{[ getRatePrice(item.pr_usd,item.pr_rate,1,item.pr_is_large_size_no_price, item.vip_usd) ]}
{[ getRatePrice(item.pr_usd, 1,1,item.pr_is_large_size_no_price, item.pr_usd) ]}
{[ getRatePrice(item.pr_usd, 1,1,item.pr_is_large_size_no_price, item.pr_usd) ]}
In Stock
- +
Please Login or Create an Account to: See VIP prices and availability
Asia Stock: Ship in 3-5 business days
EU Stock: ship in 0-1 business day
Global Stock: ship in 7-10 days
US Stock: ship in 0-1 business day
Global Stock: ship in 5-7 days
Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.
Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.
Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.
Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.
Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.
| CAS No. : | 660398-06-1 |
| Formula : | C9H6BrNO |
| M.W : | 224.05 |
| SMILES Code : | OC1=C(Br)C2=C(C=C1)C=CN=C2 |
| English Name : | 8-Bromoisoquinolin-7-ol |
| MDL No. : | MFCD17267675 |
| InChI Key : | IWMFRPFEEWSQIY-UHFFFAOYSA-N |
| Pubchem ID : | 45117038 |
| Num. heavy atoms | 12 |
| Num. arom. heavy atoms | 10 |
| Fraction Csp3 | 0.0 |
| Num. rotatable bonds | 0 |
| Num. H-bond acceptors | 2.0 |
| Num. H-bond donors | 1.0 |
| Molar Refractivity | 51.47 |
| TPSA ? Topological Polar Surface Area: Calculated from |
33.12 Ų |
| Log Po/w (iLOGP)? iLOGP: in-house physics-based method implemented from |
1.79 |
| Log Po/w (XLOGP3)? XLOGP3: Atomistic and knowledge-based method calculated by |
2.44 |
| Log Po/w (WLOGP)? WLOGP: Atomistic method implemented from |
2.7 |
| Log Po/w (MLOGP)? MLOGP: Topological method implemented from |
1.64 |
| Log Po/w (SILICOS-IT)? SILICOS-IT: Hybrid fragmental/topological method calculated by |
2.64 |
| Consensus Log Po/w? Consensus Log Po/w: Average of all five predictions |
2.24 |
| Log S (ESOL):? ESOL: Topological method implemented from |
-3.38 |
| Solubility | 0.0928 mg/ml ; 0.000414 mol/l |
| Class? Solubility class: Log S scale |
Soluble |
| Log S (Ali)? Ali: Topological method implemented from |
-2.78 |
| Solubility | 0.373 mg/ml ; 0.00166 mol/l |
| Class? Solubility class: Log S scale |
Soluble |
| Log S (SILICOS-IT)? SILICOS-IT: Fragmental method calculated by |
-3.98 |
| Solubility | 0.0232 mg/ml ; 0.000104 mol/l |
| Class? Solubility class: Log S scale |
Soluble |
| GI absorption? Gatrointestinal absorption: according to the white of the BOILED-Egg |
High |
| BBB permeant? BBB permeation: according to the yolk of the BOILED-Egg |
Yes |
| P-gp substrate? P-glycoprotein substrate: SVM model built on 1033 molecules (training set) |
No |
| CYP1A2 inhibitor? Cytochrome P450 1A2 inhibitor: SVM model built on 9145 molecules (training set) |
Yes |
| CYP2C19 inhibitor? Cytochrome P450 2C19 inhibitor: SVM model built on 9272 molecules (training set) |
No |
| CYP2C9 inhibitor? Cytochrome P450 2C9 inhibitor: SVM model built on 5940 molecules (training set) |
No |
| CYP2D6 inhibitor? Cytochrome P450 2D6 inhibitor: SVM model built on 3664 molecules (training set) |
No |
| CYP3A4 inhibitor? Cytochrome P450 3A4 inhibitor: SVM model built on 7518 molecules (training set) |
No |
| Log Kp (skin permeation)? Skin permeation: QSPR model implemented from |
-5.93 cm/s |
| Lipinski? Lipinski (Pfizer) filter: implemented from |
0.0 |
| Ghose? Ghose filter: implemented from |
None |
| Veber? Veber (GSK) filter: implemented from |
0.0 |
| Egan? Egan (Pharmacia) filter: implemented from |
0.0 |
| Muegge? Muegge (Bayer) filter: implemented from |
0.0 |
| Bioavailability Score? Abbott Bioavailability Score: Probability of F > 10% in rat |
0.55 |
| PAINS? Pan Assay Interference Structures: implemented from |
0.0 alert |
| Brenk? Structural Alert: implemented from |
0.0 alert: heavy_metal |
| Leadlikeness? Leadlikeness: implemented from |
No; 1 violation:MW<1.0 |
| Synthetic accessibility? Synthetic accessibility score: from 1 (very easy) to 10 (very difficult) |
1.39 |
* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| 69% | With D-glucose; nicotinamide adenine dinucleotide; Bs glutamate dehydrogenase; flavin reductase RebF; tryptophan halogenase RebH 3-LSR/V80A/F111G mutant; C25H27N9O15P2(2-)*2Na(1+)*H2O; sodium bromide In aq. phosphate buffer; dimethyl sulfoxide at 25℃; for 2h; Enzymatic reaction; | |
| With N-Bromosuccinimide In N,N-dimethyl-formamide at 20℃; for 2h; Inert atmosphere; |
| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| Multi-step reaction with 2 steps 1: sodium acetate; (2S)-2-{diphenyl[(trimethylsilyl)oxy]methyl}pyrrolidine / acetonitrile / 48 h / 80 °C / Inert atmosphere 2: MARVSILGAGRMGAALVRALAKAGHAVTVWNRTESKARALEPAGARTARSLVDAVDADLVIDIVSDYDTSAALLRDAEVQRALRGTTLLELASGTPAEAQRAGAWAEEHGIRYLDGAIMATPDFIGQPGCTILYSGPTELFEAHQATLRALADNGLYLGREIGHANVLDNAILVVTWGAVHGVLHGAAICEAERFSLATFRGALRGSWPVVEPLLSSALERIEGRRWAADATTQSALAPILASVRKLLAISEAHGIDAGLPQAFHRVIQRAVERGHRDDDIASAYEGMR; glucose dehydrogenase; lysozyme; deoxyribonuclease I; NADP / aq. phosphate buffer / 2 h / 15 °C / pH 7.4 / Enzymatic reaction |
| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| Multi-step reaction with 2 steps 1: sodium acetate; (2S)-2-{diphenyl[(trimethylsilyl)oxy]methyl}pyrrolidine / acetonitrile / 48 h / 80 °C / Inert atmosphere 2: MYRLLNKTAVITGGNSGIGLATAKRFVAEGAYVFIVGRRRKELEQAAAEIGRNVTAVKADVTKLEDLDRLYAIVREQRGSIDVLFANSGAIEQKTLEEITPEHYDRTFDVNVRGLIFTVQKALPLLRDGGSVILTSSVAGVLGLQAHDTYSAAKAAVRSLARTWTTELKGRSIRVNAVSPGAIDTPIIENQVSTQEEADELRAKFAAATPLGRVGRPEELAAAVLFLASDDSSYVAGIELFVDGGLTQV; lysozyme; deoxyribonuclease I; NADP / aq. phosphate buffer; isopropyl alcohol; dimethyl sulfoxide / 12 h / 25 °C / pH 7.4 / Sealed tube; Enzymatic reaction |
| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| Multi-step reaction with 2 steps 1: sodium acetate; (2S)-2-{diphenyl[(trimethylsilyl)oxy]methyl}pyrrolidine / acetonitrile / 48 h / 80 °C / Inert atmosphere 2: sodium tris(acetoxy)borohydride / dichloromethane / 0 - 20 °C |
| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| Multi-step reaction with 2 steps 1: sodium acetate; (2S)-2-{diphenyl[(trimethylsilyl)oxy]methyl}pyrrolidine / acetonitrile / 48 h / 80 °C / Inert atmosphere 2: sodium tetrahydroborate; methanol; cerium(III) chloride / 3 h / 0 °C |
| Yield | Reaction Conditions | Operation in experiment |
|---|---|---|
| 39% | With (2S)-2-{diphenyl[(trimethylsilyl)oxy]methyl}pyrrolidine; sodium acetate In acetonitrile at 80℃; for 48h; Inert atmosphere; |

A122748 [914349-55-6]
3-(3-Bromo-4-methoxyphenyl)pyridine
Similarity: 0.81