Name: Boc-Ala-OH | Boc-L-Ala-OH; Boc-Ala-OH
Brand: Ambeed
SKU: A142030

*Storage: {[sel_prStorage]}

*Shipping: {[sel_prShipping]}

Boc-Ala-OH is an alanine derivative with a protecting group, commonly used in peptide synthesis and protein engineering.

Synonyms: Boc-L-Ala-OH; Boc-Ala-OH

4.5 *For Research Use Only !

{[proInfo.pro_purity]}

Cat. No.: {[proInfo.prAm]} Purity: {[proInfo.pro_purity]}

Change View

Size	Price	VIP Price	US Stock	Global Stock	In Stock
{[ item.pr_size ]}		Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]}

US Stock: ship in 0-1 business day
Global Stock: ship in 5-7 days

{[ item.pr_size ]}

In Stock

- +

Please Login or Create an Account to: See VIP prices and availability

US Stock: ship in 0-1 business day
Global Stock: ship in 2 weeks

Quality Control of Boc-Ala-OH Purity: 97% SDS Specification

COA

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

NMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

CNMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

HPLC

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

LC-MS

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

1-2 Day Shipping
High Quality
Technical Support

Product Details of Boc-Ala-OH

CAS No. :	15761-38-3
Formula :	C₈H₁₅NO₄
M.W :	189.21
SMILES Code :	C[C@H](NC(OC(C)(C)C)=O)C(O)=O
Synonyms :	Boc-L-Ala-OH; Boc-Ala-OH
MDL No. :	MFCD00037225
InChI Key :	QVHJQCGUWFKTSE-YFKPBYRVSA-N
Pubchem ID :	85082

Safety of Boc-Ala-OH

GHS Pictogram:
Signal Word:	Warning
Hazard Statements:	H315-H319-H335
Precautionary Statements:	P261-P305+P351+P338

Application In Synthesis of Boc-Ala-OH

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

Downstream synthetic route of [ 15761-38-3 ]

[ 15761-38-3 ] Synthesis Path-Downstream 1~35

1
[ 15761-38-3 ]
[ 146844-02-2 ]
[ 59524-70-8 ]

References: [1]Bulletin of the Chemical Society of Japan,1976,vol. 49,p. 533 - 539.

2
[ 15761-38-3 ]
D-γ-methyl isoglutamine hydrochloride [ No CAS ]
[ 18814-49-8 ]

References: [1]Bulletin of the Chemical Society of Japan,1976,vol. 49,p. 533 - 539.
[2]Helvetica Chimica Acta,1993,vol. 76,p. 2951 - 2957.

3
[ 15761-38-3 ]
[ 87137-45-9 ]
[ 18814-49-8 ]

References: [1]Journal of Medicinal Chemistry,1983,vol. 26,p. 1729 - 1732.

4
[ 15761-38-3 ]
[ 6404-26-8 ]
[ 55297-72-8 ]
resin esterified with Boc-D-Ala-OH [ No CAS ]
[ 76491-49-1 ]

References: [1]Collection of Czechoslovak Chemical Communications,1980,vol. 45,p. 1424 - 1446.

5
[ 15761-38-3 ]
[ 40350-83-2 ]
(±)-1-azafagomine [ No CAS ]
[ 541-88-8 ]
(2S,4R)-1-{(2S,4R)-1-[2-(4,5-Dihydroxy-3-hydroxymethyl-tetrahydro-pyridazin-1-yl)-acetyl]-4-hydroxy-pyrrolidine-2-carbonyl}-4-hydroxy-pyrrolidine-2-carboxylic acid ((S)-1-carbamoyl-ethyl)-amide [ No CAS ]

References: [1]Bioorganic and Medicinal Chemistry,1999,vol. 7,p. 1965 - 1971.

6
[ 506-68-3 ]
[ 15761-38-3 ]
[ 3262-72-4 ]
[ 53308-95-5 ]
4-methylbenzhydrylamine resin [ No CAS ]
(R)-2-((S)-2-Imino-4-methyl-imidazolidin-1-yl)-3-((S)-2-imino-5-propyl-imidazolidin-1-yl)-propan-1-ol [ No CAS ]

References: [1]Tetrahedron,2001,vol. 57,p. 9911 - 9914.

7
[ 1128-56-9 ]
[ 15761-38-3 ]
[1-(1-phenyl-1H-pyrazol-3-ylcarbamoyl)-ethyl]-carbamic acid tert-butyl ester [ No CAS ]

References: [1]Bioorganic and Medicinal Chemistry Letters,2005,vol. 15,p. 771 - 775.

8
[ 15761-38-3 ]
resin-HMPA-LAAFNH₂ [ No CAS ]
[ 18814-49-8 ]

References: [1]Chemistry of Natural Compounds,1998,vol. 34,p. 78 - 79.

9
[ 15761-38-3 ]
[ 18814-49-8 ]

References: [1]Bulletin of the Chemical Society of Japan,1980,vol. 53,p. 2570 - 2577.
[2]Carbohydrate Research,1984,vol. 132,p. 275 - 286.
[3]Chinese Chemical Letters,2011,vol. 22,p. 1443 - 1446.
[4]Patent: EP2612857,2017,B1 .

10
[ 15761-38-3 ]
[ 1479-58-9 ]
(S)-{1-[4-bromo-2-(2-fluoro-benzoyl)-phenylcarbamoyl]-ethyl}-carbamic acid tert-butyl ester [ No CAS ]
[ 2387-23-7 ]

Yield	Reaction Conditions	Operation in experiment
79%	With dicyclohexyl-carbodiimide; In dichloromethane; at 0 - 20℃; for 8.5h;	{1-[4-Bromo-2-(2-fluoro-benzoyl)-phenylcarbamoyl]-ethyl}-carbamic acid tert-butyl ester 116.; To a stirred solution of <strong>[1479-58-9](2-amino-5-bromophenyl)-(2-fluoro-phenyl)-methanone</strong> (60 g, 204 mmol) 115 and the N-Boc-L-alanine 107 (38.59 g, 204 mmol) in CH2Cl2 (500 mL) was added dicyclohexylcarbodiimide (DCC) (42.09 g, 204 mmol) in CH2Cl2 (200 mL) dropwise, over a 30 min period at 0° C. The reaction mixture was allowed to stir an additional 8 h at rt. The dicyclohexyl urea which formed was filtered off and the filtrate concentrated under reduced pressure. The crude solid residue 116 was purified by recrystallization from hexane and EtOAc to afford 116 (74.9 g, 79percent). mp 158-159° C.; IR (KBr, cm-1) 3332, 2931, 255, 1694, 1643, 1613, 1582, 1537, 1450; 1H NMR (CDCl3) delta 11.68 (s, 1H), 8.71 (d, J=9.0 Hz, 1H), 7.69 (dd, J=9.0, 2.3 Hz, 1H), 7.55-7.62 (m, 2H), 7.46 (td, J=7.6, 1.4 Hz, 1H), 7.30 (t, J=7.5 Hz, 1H), 7.21 (t, J=9.1 Hz, 1H), 5.13 (b, 1H), 4.37 (b, 1H), 1.51 (d, J=7.2 Hz, 3H), 1.45 (S, 9H). MS (EI) m/e (relative intensity) 467 (M++2, 14), 466 (M++1, 44), 465 (M+, 14), 464 (42), 329 (15), 321 (60), 295 (100), 224 (26); [alpha]26D=-59.1 (c 0.51, EtOAc).

References: [1]Patent: US2006/3995,2006,A1 .Location in patent: Page/Page column 58-59.

11
[ 15761-39-4 ]
[ 13734-41-3 ]
[ 13139-15-6 ]
[ 15761-38-3 ]
C₁₆H₂₈N₃O₅PolS [ No CAS ]
[ 7536-55-2 ]
[ 13726-85-7 ]
[ 13574-13-5 ]
[ 13836-37-8 ]
[ 23680-31-1 ]
[ 47355-10-2 ]
[ 83468-83-1 ]
Fmoc-Asp-Cys(Acm)-His-Leu-Gln-Ala-Val-Val-Leu-His-Leu-Ala-Arg-Arg-Ser-Val-Cys(Acm)-Val-His-Pro-Gln-Asn-Arg-Ser-Leu-Ala-Arg-Trp-Leu-Glu-Arg-Gln-Gly-S-CH₂CH₂CO-Leu-NH₂ [ No CAS ]

References: [1]Organic and Biomolecular Chemistry,2008,vol. 6,p. 1808 - 1813.

12
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 7536-58-5 ]
[ 13734-34-4 ]
[ 47355-10-2 ]
[ 2188-18-3 ]
c-(ADLRWF) [ No CAS ]

References: [1]Bioorganic and Medicinal Chemistry,2010,vol. 18,p. 6099 - 6108.

13
[ 15761-38-3 ]
[ 124-41-4 ]
[ 3034-48-8 ]
[ 88374-44-1 ]

References: [1]Russian Journal of General Chemistry,2010,vol. 80,p. 2572 - 2589.

14
[ 15761-38-3 ]
[ 2886-33-1 ]
[ 84668-69-9 ]

References: [1]Chemistry - An Asian Journal,2011,vol. 6,p. 1163 - 1170.
[2]ChemBioChem,2013,vol. 14,p. 625 - 632.

15
[ 4530-20-5 ]
[ 13734-41-3 ]
[ 13139-16-7 ]
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 13734-34-4 ]
[ 13836-37-8 ]
[ 73821-97-3 ]
[ 54613-99-9 ]
[ 47689-67-8 ]
[ 47355-10-2 ]
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH [ No CAS ]

References: [1]Journal of Peptide Science,2011,vol. 17,p. 218 - 225.

16
[ 112392-66-2 ]
[ 15761-38-3 ]
[ 91103-47-8 ]

Yield	Reaction Conditions	Operation in experiment
	With lyophilized cells of Bacillus amyloliquefaciens WZZ002; In aq. phosphate buffer; at 35℃; for 10h;pH 8.0;Enzymatic reaction;Kinetics;	Enantioselective hydrolysis was performed on Boc-dl-Ala-OMe by adding both a substrate with a concentration range of 0.1 to 4.0M and a 500mg lyophilized cell of B. amyloliquefaciens WZZ002 in a 10mL (50mL flask) phosphate buffer solution (0.2M, pH6.0-12.0) at 20C to 60C. The solution was stirred at 400rpm. The pH level was controlled through automatic titration using different alkali solutions (2M). The samples were withdrawn at regular intervals and were immediately acidified with HCl (2M) to stop the reaction and to enhance the extractability of Boc-dl-Ala. The sample was extracted using ethyl acetate, whereas the organic phase was isolated and dried using anhydrous Na2SO4 for gas chromatography (GC) analysis. All experiments were conducted in triplicate, unless specified. The time course of enantioselective hydrolysis reaction was performed by adding 2M of Boc-dl-Ala-OMe and 5g of the lyophilized cell of B. amyloliquefaciens WZZ002 in 100mL (250mL flask) phosphate buffer solution (0.2M, pH8.0). The pH of the reaction was controlled through automatic titration using 6M of NH3·H2O to reduce the increasing amount of the neutralizer.

References: [1]Catalysis Communications,2014,vol. 60,p. 134 - 137.

17
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 19746-37-3 ]
[ 13836-37-8 ]
C₂₅H₃₈N₃O₆PolS [ No CAS ]
[ 47689-67-8 ]
[ 170384-29-9 ]
C₇₈H₁₀₈BrN₁₆O₂₁PolS₃ [ No CAS ]

References: [1]Organic Letters,2015,vol. 17,p. 1806 - 1809.

18
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 13836-37-8 ]
C₂₅H₃₈N₃O₆PolS [ No CAS ]
[ 61925-77-7 ]
[ 47689-67-8 ]
[ 170384-29-9 ]
C₈₂H₁₀₉BrN₁₅O₂₀PolS₃ [ No CAS ]

References: [1]Organic Letters,2015,vol. 17,p. 1806 - 1809.

19
polyethylene glycol polyamide resin [ No CAS ]
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 13139-16-7 ]
[ 15260-10-3 ]
[ 13836-37-8 ]
[ 23680-31-1 ]
[ 61925-77-7 ]
[ 73821-97-3 ]
[ 47689-67-8 ]
[ 83468-83-1 ]
[ 65420-40-8 ]
[ 170384-29-9 ]
H-CSCRLYELLHGAGNHAAGILTL-NH₂ [ No CAS ]