Name: Fmoc-Trp(Boc)-OH | Fmoc-L-Trp(Boc)-OH
Brand: Ambeed
SKU: A166121
Rating: 4.8 (100 reviews)

*Storage: {[sel_prStorage]}

*Shipping: {[sel_prShipping]}

Fmoc-Trp(Boc)-OH is a tryptophan derivative with self-assembling and nanoparticle-forming capabilities, useful in anticancer drug delivery research.

Synonyms: Fmoc-L-Trp(Boc)-OH

4.5 *For Research Use Only !

{[proInfo.pro_purity]}

Cat. No.: {[proInfo.prAm]} Purity: {[proInfo.pro_purity]}

Change View

Size	Price	VIP Price	US Stock	Global Stock	In Stock
{[ item.pr_size ]}		Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]}

US Stock: ship in 0-1 business day
Global Stock: ship in 5-7 days

{[ item.pr_size ]}

In Stock

- +

Please Login or Create an Account to: See VIP prices and availability

US Stock: ship in 0-1 business day
Global Stock: ship in 2 weeks

Quality Control of Fmoc-Trp(Boc)-OH Purity: 98% SDS Specification

COA

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

NMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

CNMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

HPLC

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

LC-MS

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

1-2 Day Shipping
High Quality
Technical Support

Product Citations

Non-Invasive Ultrasonic Debridement of Implant Biofilms Via Hydrogen-Sulfide Releasing Peptide Nanoemulsions

Singh, Harminder ; Biswas, Diptomit ; Medina, Scott ;

DOI: 10.2139/ssrn.5044770 Pennsylvania State University,2024.

Abstract: Implant contamination by bacterial biofilms remains a significant healthcare burden, often necessitating revision surgeries due to biofilm-enabled antibiotic resistance. Physical debridement, in combination with chemical antiseptics, is a simple and effective therapeutic strategy, but requires highly invasive surgical procedures and risks secondary infection events. Herein, we report a non-invasive, nanoparticle-enabled ultrasonic debridement strategy that exerts synergistic physical and chemical antiseptic effects to rapidly and efficiently clear implant-associated biofilms in situ. This approach is realized through the development of hydrogen sulfide- releasing peptide nanoemulsions that preferentially target bacterial biofilms and can be vaporized via diagnostic ultrasound to spatiotemporally clear methicillin-resistant Staphylococcus aureus (MRSA) infections. Biophysical studies elucidate the mechanistic basis for the platform’s antibiofilm activity, and in vitro and ex vivo experiments confirm efficacy in the context of MRSA-infected titanium implants. By exploiting the portable, low cost and safe nature of low intensity diagnostic ultrasound, this non-invasive approach avoids the collateral tissue damage associated with current surgical and high intensity acoustic ablative modalities.

Purchased from AmBeed: 154445-77-9 ; 143824-78-6

Product Details of Fmoc-Trp(Boc)-OH

CAS No. :	143824-78-6
Formula :	C₃₁H₃₀N₂O₆
M.W :	526.57
SMILES Code :	O=C(O)[C@H](CC1=CN(C(OC(C)(C)C)=O)C2=CC=CC=C12)NC(OCC3C4=C(C5=C3C=CC=C5)C=CC=C4)=O
Synonyms :	Fmoc-L-Trp(Boc)-OH
MDL No. :	MFCD00153366
InChI Key :	ADOHASQZJSJZBT-SANMLTNESA-N
Pubchem ID :	9849766

Safety of Fmoc-Trp(Boc)-OH

GHS Pictogram:
Signal Word:	Warning
Hazard Statements:	H302-H315-H319-H335
Precautionary Statements:	P261-P305+P351+P338

Application In Synthesis of Fmoc-Trp(Boc)-OH

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

Downstream synthetic route of [ 143824-78-6 ]

[ 143824-78-6 ] Synthesis Path-Downstream 1~36

1
[ 811434-05-6 ]
[ 124-07-2 ]
Fmoc-Thr(Bzl)-O-HMP-resin [ No CAS ]
[ 86123-10-6 ]
[ 125238-99-5 ]
[ 117872-75-0 ]
[ 143824-78-6 ]
C₁₁₄H₁₃₄Cl₅N₁₇O₂₄ [ No CAS ]

References: [1]Chemical and Pharmaceutical Bulletin,2009,vol. 57,p. 240 - 244.

2
[ 811434-05-6 ]
C₂₆H₂₄NO₅Pol [ No CAS ]
[ 35661-60-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
[ 117872-75-0 ]
[ 143824-78-6 ]
[ 1173986-45-2 ]

References: [1]Chemical and Pharmaceutical Bulletin,2009,vol. 57,p. 332 - 336.

3
[ 68858-20-8 ]
[ 35661-40-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 96402-49-2 ]
[ 143824-78-6 ]
Fmoc-S-trityl penicillamine [ No CAS ]
C₆₁H₇₆N₁₀O₁₀S₂ [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2009,vol. 52,p. 3927 - 3940.

4
C₂₇H₃₁ClNO₂Pol [ No CAS ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 96402-49-2 ]
[ 146549-21-5 ]
[ 143824-78-6 ]
[ 1241047-38-0 ]

References: [1]Journal of Medicinal Chemistry,2010,vol. 53,p. 6188 - 6197.

5
C₂₇H₃₁ClNO₂Pol [ No CAS ]
[ 71989-26-9 ]
[ 71989-40-7 ]
[ 86123-10-6 ]
[ 96402-49-2 ]
[ 146549-21-5 ]
[ 143824-78-6 ]
[ 1241047-41-5 ]

References: [1]Journal of Medicinal Chemistry,2010,vol. 53,p. 6188 - 6197.

6
[ 4497-04-5 ]
C₄₂H₄₁N₄O₈Pol [ No CAS ]
[ 143824-78-6 ]
[ 1241875-27-3 ]

References: [1]Journal of Combinatorial Chemistry,2010,vol. 12,p. 676 - 686.

7
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
H-(propargylglycyl)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-NH₂ [ No CAS ]

References: [1]Journal of Peptide Science,2011,vol. 17,p. 270 - 280.

8
[ 68858-20-8 ]
[ 35661-40-6 ]
[ 71989-14-5 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 96402-49-2 ]
[ 143824-78-6 ]
Fmoc-[β-dimethylcysteine](Trt)-OH [ No CAS ]
C₅₆H₇₂N₁₀O₁₁S₂ [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2014,vol. 57,p. 5965 - 5974.

9
[ 159610-89-6 ]
[ 108-24-7 ]
[ 86123-10-6 ]
[ 109425-51-6 ]
[ 77284-32-3 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
Ac-Nle-Pra-His-D-Phe-Arg-Trp-Nle(ε-N_3)-NH2 [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2014,vol. 57,p. 9424 - 9434.

10
[ 159610-89-6 ]
[ 108-24-7 ]
[ 86123-10-6 ]
[ 109425-51-6 ]
[ 77284-32-3 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
Ac-Nle-Nle(N<SUB>3</SUB>)-His-D-Phe-Arg-Trp-Pra-NH<SUB>2</SUB> [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2014,vol. 57,p. 9424 - 9434.

11
C₂₃H₂₂NO₆Pol [ No CAS ]
C₁₇H₃₅NO₅Si [ No CAS ]
[ 35661-60-0 ]
[ 132327-80-1 ]
[ 77128-73-5 ]
[ 71989-33-8 ]
[ 56-40-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
N-FMOC-O-tert-butyl-D-threonine [ No CAS ]
Fmoc-D-Ile-OH [ No CAS ]
C₇₅H₁₁₆N₂₀O₂₀ [ No CAS ]

References: [1]Angewandte Chemie - International Edition,2015,vol. 54,p. 1556 - 1560.
Angew. Chem.,2015,vol. 127,p. 1576 - 1580,5.

12
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
DCLGA-(L-1-naphthylalanyl)-RKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH₂; disulfide linked (C2→C17, C9→C23, C16→C30) [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 2299 - 2314.

13
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
DCLGF-(L-1-naphthylalanyl)-RKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH₂; disulfide linked (C2→C17, C9→C23, C16→C30) [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 2299 - 2314.

14
[ 35661-60-0 ]
[ 35661-51-9 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 108-24-7 ]
[ 71989-38-3 ]
[ 132388-59-1 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
Ac-Tyr-Asn-Trp-Asn-Ser-Phe-azaGly-Leu-Arg-Tyr-NH₂ [ No CAS ]

References: [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 3459 - 3470.

15
fmoc-Phe-Alko Resin [ No CAS ]
[ 29022-11-5 ]
[ 143824-78-6 ]
[ 198561-07-8 ]
C₄₂H₃₉N₅O₇ [ No CAS ]

References: [1]New Journal of Chemistry,2015,vol. 39,p. 4534 - 4550.

16
H-Trp(Boc)-2-chlorotrityl chloride resin [ No CAS ]
[ 143824-78-6 ]
[ 198561-07-8 ]
C₆₀H₅₇N₁₁O₇ [ No CAS ]

References: [1]ChemMedChem,2014,vol. 9,p. 2449 - 2453.

17
H-Trp(Boc)-2-chlorotrityl chloride resin [ No CAS ]
[ 143824-78-6 ]
[ 198561-07-8 ]
C₈₅H₉₇N₁₁O₁₇ [ No CAS ]

References: [1]ChemMedChem,2014,vol. 9,p. 2449 - 2453.

18
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
XCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF amide; X=3-(1-naphthyl)-L-alanine [ No CAS ]