Boc-Aib-OH | 2-((tert-Butoxycarbonyl)amino)-2-methylpropanoic acid | N-protective Amino Acid

Boc-Aib-OH is a protected aminoisobutyric acid derivative with the amino group protected by tert-butoxycarbonyl (Boc), used for synthesizing peptides with special structures.

Synonyms: 2-((tert-Butoxycarbonyl)amino)-2-methylpropanoic acid

4.5 *For Research Use Only !

{[proInfo.pro_purity]}

Cat. No.: {[proInfo.prAm]} Purity: {[proInfo.pro_purity]}

Change View

Size	Price	VIP Price	US Stock	Global Stock	In Stock
{[ item.pr_size ]}		Inquiry {[ getRatePrice(item.pr_usd,item.pr_rate,item.mem_rate,item.pr_is_large_size_no_price, item.vip_usd) ]}

US Stock: ship in 0-1 business day
Global Stock: ship in 5-7 days

{[ item.pr_size ]}

In Stock

- +

Please Login or Create an Account to: See VIP prices and availability

US Stock: ship in 0-1 business day
Global Stock: ship in 2 weeks

Quality Control of Boc-Aib-OH Purity: 97% SDS Specification

COA

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

NMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

CNMR

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

HPLC

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

LC-MS

Search for reports by entering the product batch number.
Batch number can be found on the product's label following the word 'Batch'.

1-2 Day Shipping
High Quality
Technical Support

Product Details of Boc-Aib-OH

CAS No. :	30992-29-1
Formula :	C₉H₁₇NO₄
M.W :	203.24
SMILES Code :	CC(C)(NC(OC(C)(C)C)=O)C(O)=O
Synonyms :	2-((tert-Butoxycarbonyl)amino)-2-methylpropanoic acid
MDL No. :	MFCD00042973
InChI Key :	MFNXWZGIFWJHMI-UHFFFAOYSA-N
Pubchem ID :	2733845

Safety of Boc-Aib-OH

GHS Pictogram:
Signal Word:	Warning
Hazard Statements:	H315-H319-H335
Precautionary Statements:	P261-P305+P351+P338

Application In Synthesis of Boc-Aib-OH

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

Upstream synthesis route of [ 30992-29-1 ]
Downstream synthetic route of [ 30992-29-1 ]

[ 30992-29-1 ] Synthesis Path-Upstream 1~2

1
[ 30992-29-1 ]
[ 73470-46-9 ]

Yield	Reaction Conditions	Operation in experiment
88%	Stage #1: With pyridine; di-<i>tert</i>-butyl dicarbonate In acetonitrile at 20℃; for 0.333333 h; Stage #2: With ammonia In water; acetonitrile for 4.33333 h;	A mixture of 2-(tert-butoxycarbonylamino)-2-methylpropanoic acid (CAN: 30992-29-1, 20 g, 98 mmol), di-tert-butyl dicarbonate (CAN 24424-99-5, 27.67 g, 147 mmol) and pyridine (4.6 mL) in acetonitrile (500 mL) was stirred at room temperature for 20 min. Ammonia (10 mL) was added dropwise for 20 min. The resulting reaction mixture was stirred for 4 h. After removal of most of the solvent under reduced pressure, the solid was filtered off and washed with acetonitrile. The solid was brought to dryness under reduced pressure to give the title compound (17.5 g, 88percent) as white solid; MS (EI): m/e 225.1 [M+Na]⁺.
88%	Stage #1: With pyridine; di-<i>tert</i>-butyl dicarbonate In acetonitrile at 20℃; for 0.333333 h; Stage #2: With ammonia In acetonitrile for 4.3 h;	A mixture of 2-(tert-butoxycarbonylamino)-2-methylpropanoic acid (CAN: 30992-29-1, 20 g, 98 mmol), di-tert-butyl dicarbonate (CAN 24424-99-5, 27.67 g, 147 mmol) and pyridine (4.6 mL) in acetonitrile (500 mL) was stirred at room temperature for 20 min. Ammonia (10 mL) was added dropwise for 20 min. The resulting reaction mixture was stirred for 4 h. After removal of most of the solvent under reduced pressure, the solid was filtered off and washed with acetonitrile. The solid was brought to dryness under reduced pressure to give the title compound (17.5 g, 88percent) as white solid; MS(EI): m/e 225.1 [M+Na]⁺.

References: [1] Patent: US2012/316147, 2012, A1, . Location in patent: Page/Page column 33-34.
[2] Patent: WO2012/168350, 2012, A1, . Location in patent: Page/Page column 80.
[3] Tetrahedron, 2004, vol. 60, # 40, p. 8929 - 8936.
[4] Tetrahedron Letters, 2000, vol. 41, # 50, p. 9809 - 9813.
[5] Tetrahedron Letters, 2003, vol. 44, # 3, p. 463 - 466.
[6] Journal of Heterocyclic Chemistry, 1981, vol. 18, # 8, p. 1629 - 1633.
[7] Journal of Medicinal Chemistry, 2002, vol. 45, # 25, p. 5471 - 5482.
[8] Patent: WO2009/70485, 2009, A1, . Location in patent: Page/Page column 102.

2
[ 24424-99-5 ]
[ 30992-29-1 ]
[ 73470-46-9 ]

References: [1] Patent: WO2008/17691, 2008, A1, . Location in patent: Page/Page column 24.
[2] Patent: WO2008/17691, 2008, A1, . Location in patent: Page/Page column 24-25.

[ 30992-29-1 ] Synthesis Path-Downstream 1~19

1
[ 30992-29-1 ]
[ 5131-60-2 ]
1,1-dimethylethyl {2-[(3-amino-4-chlorophenyl)amino]-1,1-dimethyl-2-oxoethyl}carbamate [ No CAS ]

Yield	Reaction Conditions	Operation in experiment
33%	With benzotriazol-1-yloxyl-tris-(pyrrolidino)-phosphonium hexafluorophosphate; N-ethyl-N,N-diisopropylamine; In dichloromethane; for 18h;	Benzotriazol-1-yloxytripyrrolidinophosphonium hexafluorophosphate (4.00 g, 7.69 mmol) was added to a mixture of 4-chloro-1 ,3-phenylenediamine (1.00 g, 7.01 mmol), N-(te/f-butoxycarbonyl)-2-aminoisobutyric acid (1.60 g, 7.87 mmol), N,N-diisopropylethylamine (3.00 mL, 17.2 mmol) and dichloromethane (7 ml_) and the mixture stirred 18 h under nitrogen. The mixture was diluted with ethyl acetate, washed with 1 M aqueous hydrochloric acid and brine, then dried (MgSO4). The solvent was removed under reduced pressure and the residue EPO <DP n="118"/>chromatographed (silica gel, 10-50percent ethyl acetate/hexane) to give the title compound (0.75 g, 33percent) as a solid. 1 H NMR (400 MHz, DMSO-c/6) delta ppm 1.36 (m, 15 H) 5.29 (s, 2 H) 6.73 (br s, 1 H) 6.88 (br s, 1 H) 7.05 (d, J=8.59 Hz, 1 H) 7.20 (s, 1 H) 9.21 (s, 1 H)

References: [1]Patent: WO2006/127458,2006,A2 .Location in patent: Page/Page column 116-117.

2
[ 13734-41-3 ]
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 2488-15-5 ]
[ 30992-29-1 ]
[ 13726-85-7 ]
[ 13734-34-4 ]
[ 15260-10-3 ]
[ 13836-37-8 ]
[ 73821-95-1 ]
[ 47355-10-2 ]
[ 65420-40-8 ]
HXQGTFTSDYSKYLDERRAQDFVQWLMNT-NH₂; X=Aib [ No CAS ]

References: [1]Journal of Peptide Science,2011,vol. 17,p. 659 - 666.

3
[ 13734-41-3 ]
[ 13139-15-6 ]
[ 15761-38-3 ]
[ 30992-29-1 ]
[ 15260-10-3 ]
[ 13836-37-8 ]
C₉₉H₁₄₃ClN₁₉O₂₃PolS [ No CAS ]
[ 73821-95-1 ]
[ 18942-49-9 ]
[ 73821-97-3 ]
[ 6404-28-0 ]
[ 108-24-7 ]
[ 55260-24-7 ]
Boc-C^αMeLeu-OH [ No CAS ]
[ 25024-53-7 ]
cyclo(30−33)[D-Phe¹², Nle^21,38,Aib^27,40,Glu³⁰,Lys³³]-acetyl-{human/rat corticotropin releasing factor}(9−41) [ No CAS ]