[ CAS No. 71989-35-0 ] {[proInfo.proName]}

Name: 71989-35-0|Fmoc-Thr(tBu)-OH|97%
Brand: Ambeed
SKU: A415744
Price: 7.0 USD
Availability: InStock
Rating: 95 (35 reviews)

,{[proInfo.pro_purity]}

Cat. No.: {[proInfo.prAm]}

DV 2D 3D

3d Animation Molecule Structure of 71989-35-0

Structure of 71989-35-0 * Storage: {[proInfo.prStorage]}

Cart0 Add to My Favorites Add to My Favorites Bulk Inquiry Inquiry Add To Cart

Search after Editing

* Storage: {[proInfo.prStorage]}

For Research Only 110K+ Compounds Competitive Price 1-2 Day Shipping

Quality Control of [ 71989-35-0 ]

COA NMR CNMR HPLC LC-MS

Related Doc. of [ 71989-35-0 ]

SDS Specification

Alternatived Products of [ 71989-35-0 ]

Product Details of [ 71989-35-0 ]

CAS No. :	71989-35-0	MDL No. :	MFCD00077075
Formula :	C₂₃H₂₇NO₅	Boiling Point :	-
Linear Structure Formula :	-	InChI Key :	-
M.W :	397.46	Pubchem ID :	-
Synonyms :

Calculated chemistry of [ 71989-35-0 ]

Physicochemical Properties

Num. heavy atoms :	29
Num. arom. heavy atoms :	12
Fraction Csp3 :	0.39
Num. rotatable bonds :	9
Num. H-bond acceptors :	5.0
Num. H-bond donors :	2.0
Molar Refractivity :	110.33
TPSA :	84.86 Å²

Pharmacokinetics

GI absorption :	High
BBB permeant :	No
P-gp substrate :	Yes
CYP1A2 inhibitor :	No
CYP2C19 inhibitor :	No
CYP2C9 inhibitor :	Yes
CYP2D6 inhibitor :	No
CYP3A4 inhibitor :	Yes
Log Kp (skin permeation) :	-5.91 cm/s

Lipophilicity

Log Po/w (iLOGP) :	2.79
Log Po/w (XLOGP3) :	3.96
Log Po/w (WLOGP) :	4.18
Log Po/w (MLOGP) :	2.62
Log Po/w (SILICOS-IT) :	3.59
Consensus Log Po/w :	3.43

Druglikeness

Lipinski :	0.0
Ghose :	None
Veber :	0.0
Egan :	0.0
Muegge :	0.0
Bioavailability Score :	0.56

Water Solubility

Log S (ESOL) :	-4.51
Solubility :	0.0122 mg/ml ; 0.0000308 mol/l
Class :	Moderately soluble
Log S (Ali) :	-5.44
Solubility :	0.00143 mg/ml ; 0.00000361 mol/l
Class :	Moderately soluble
Log S (SILICOS-IT) :	-5.83
Solubility :	0.000583 mg/ml ; 0.00000147 mol/l
Class :	Moderately soluble

Medicinal Chemistry

PAINS :	0.0 alert
Brenk :	0.0 alert
Leadlikeness :	3.0
Synthetic accessibility :	4.49

Safety of [ 71989-35-0 ]

Signal Word:	Warning	Class:	N/A
Precautionary Statements:	P261-P305+P351+P338	UN#:	N/A
Hazard Statements:	H302-H315-H319-H335	Packing Group:	N/A
GHS Pictogram:

Application In Synthesis of [ 71989-35-0 ]

* All experimental methods are cited from the reference, please refer to the original source for details. We do not guarantee the accuracy of the content in the reference.

Upstream synthesis route of [ 71989-35-0 ]
Downstream synthetic route of [ 71989-35-0 ]

[ 71989-35-0 ] Synthesis Path-Upstream 1~11

1
[ 71989-35-0 ]
[ 4378-13-6 ]

Reference： [1] Amino Acids, 2014, vol. 46, # 2, p. 367 - 374
[2] Patent: WO2012/136604, 2012, A1, . Location in patent: Page/Page column 42

2
[ 71989-35-0 ]
[ 4425-82-5 ]
[ 4378-13-6 ]

Reference： [1] Chimia, 2010, vol. 64, # 3, p. 200 - 202

3
[ 4378-13-6 ]
[ 102774-86-7 ]
[ 71989-35-0 ]

Reference： [1] Liebigs Annalen der Chemie, 1988, p. 1095 - 1098

4
[ 275827-11-7 ]
[ 71989-35-0 ]

Reference： [1] Synlett, 2000, # 3, p. 400 - 402

5
[ 28920-43-6 ]
[ 1254943-38-8 ]
[ 71989-35-0 ]

Reference： [1] Journal of Organic Chemistry, 2012, vol. 77, # 23, p. 10575 - 10582

6
[ 73731-37-0 ]
[ 71989-35-0 ]

Reference： [1] Tetrahedron Letters, 1992, vol. 33, # 49, p. 7605 - 7608

7
[ 82911-69-1 ]
[ 132776-34-2 ]
[ 71989-35-0 ]

Reference： [1] Journal of Organic Chemistry, 1991, vol. 56, # 10, p. 3447 - 3449

8
[ 146346-73-8 ]
[ 71989-35-0 ]

Reference： [1] Tetrahedron Letters, 1992, vol. 33, # 49, p. 7605 - 7608

9
[ 125760-27-2 ]
[ 71989-35-0 ]

Reference： [1] Tetrahedron Letters, 1992, vol. 33, # 49, p. 7605 - 7608

10
[ 71989-35-0 ]
[ 73731-37-0 ]

Reference： [1] Organic Letters, 2012, vol. 14, # 24, p. 6346 - 6349

11
[ 71989-35-0 ]
[ 189337-28-8 ]

Reference： [1] Angewandte Chemie - International Edition, 2010, vol. 49, # 1, p. 117 - 120
[2] Patent: US2003/229017, 2003, A1, . Location in patent: Page 12
[3] Organic and Biomolecular Chemistry, 2018, vol. 16, # 26, p. 4874 - 4880
[4] Patent: US2003/229013, 2003, A1, . Location in patent: Page 13

[ 71989-35-0 ] Synthesis Path-Downstream 1~88

1
[ 13734-38-8 ]
[ 71989-35-0 ]
(2S,4R)-4-tert-butoxy-1-(9H-fluoren-9-ylmethoxycarbonyl)pyrrolidine-2-carboxylic acid [ No CAS ]
[ 296774-48-6 ]
FmocOrn(Aloc)OH 2,4,5-trichlorophenyl 4"-pentyloxyterphenoateFmoc-4(S)-AzpOH [ No CAS ]
4''-pentyloxy-[1,1';4',1'']terphenyl-4-carboxylic acid {26-amino-11-hydroxy-15-(1-hydroxy-ethyl)-3-hydroxymethyl-6-[2-(4-hydroxy-phenyl)-ethyl]-2,5,8,14,17,23-hexaoxo-1,4,7,13,16,22-hexaaza-tricyclo[22.3.0.0^9,13]heptacos-18-yl}-amide [ No CAS ]

Reference： [1]Bioorganic and Medicinal Chemistry,2000,vol. 8,p. 1677 - 1696

2
Fmoc-Rink resin [ No CAS ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
C₁₇₅H₂₁₄N₂₁O₂₄PolS₃ [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2008,vol. 130,p. 14625 - 14633

3
Fmoc-Rink resin [ No CAS ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 96402-49-2 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
C₁₃₁H₁₇₆N₁₉O₂₂PolS [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2008,vol. 130,p. 14625 - 14633

4
Fmoc-Rink resin [ No CAS ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 118358-38-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
C₁₈₅H₂₂₄N₂₁O₃₃PolS₃ [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2008,vol. 130,p. 14625 - 14633

5
Fmoc-Rink resin [ No CAS ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 96402-49-2 ]
[ 118358-38-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
C₁₄₁H₁₈₆N₁₉O₃₁PolS [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2008,vol. 130,p. 14625 - 14633

6
Fmoc-Rink resin [ No CAS ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 108-24-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
C₇₇H₉₉N₁₂O₁₃PolS [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2008,vol. 130,p. 14625 - 14633

7
C₃₃H₃₄N₃O₅Pol [ No CAS ]
[ 29022-11-5 ]
[ 35661-39-3 ]
[ 122889-11-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-18-9 ]
[ 71989-35-0 ]
[ 109425-51-6 ]
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Ser(OBn)-[2-amino-3-(biphenyl-4-yl)propanoyl]-NH₂ [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2009,vol. 52,p. 7788 - 7799

8
C₂₇H₃₁ClNO₂Pol [ No CAS ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 96402-49-2 ]
[ 146549-21-5 ]
[ 143824-78-6 ]
[ 1241047-38-0 ]

Reference： [1]Journal of Medicinal Chemistry,2010,vol. 53,p. 6188 - 6197

9
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
H-(propargylglycyl)-QGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-NH₂ [ No CAS ]

Reference： [1]Journal of Peptide Science,2011,vol. 17,p. 270 - 280

10
[ 35661-39-3 ]
C₃₆H₃₇N₂O₆Pol [ No CAS ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 198561-07-8 ]
[ 684270-46-0 ]
C₂₆H₄₅N₉O₉ [ No CAS ]
[ 1372190-73-2 ]
[ 1372190-70-9 ]

Yield	Reaction Conditions	Operation in experiment
		Lys(Boc)-Pra-Asn(Trt)-Thr(tBu)-Ala-Thr(tBu)-Ala(N3)-Ala-Pal-PEG resin (16) (0.498 g, 0.09 mmol) was cleaved with TFA/iPr3SiH/H2O (v/v/v; 95/2.5/2.5, 5.0 mL) for 2 h, peptide was isolated as described in the general section to afford 47.3 mg of crude peptide 17. The crude peptide 17 (16.3 mg) was purified by RP-HPLC on a preparative Phenomenex Gemini C18, column at a flow rate of 5 mL min-1, using a linear gradient of 1percentB to 61percentB over 60 min (ca. 1percentB per minute) and lyophilised to give the title compound 17 as a white amorphous solid (4.9 mg, 18percent).

Reference： [1]Bioorganic and Medicinal Chemistry,2012,vol. 20,p. 2661 - 2668

11
[ 35661-39-3 ]
C₃₆H₃₇N₂O₆Pol [ No CAS ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 198561-07-8 ]
[ 684270-46-0 ]
[ 1372190-73-2 ]
[ 1372190-65-2 ]

Yield	Reaction Conditions	Operation in experiment
		Lys(Boc)-Pra-Asn(Trt)-Thr(tBu)-Ala-Thr(tBu)-Ala(N3)-Ala-Pal-PEG resin (16) (0.498 g, 0.09 mmol) was cleaved with TFA/iPr3SiH/H2O (v/v/v; 95/2.5/2.5, 5.0 mL) for 2 h, peptide was isolated as described in the general section to afford 47.3 mg of crude peptide 17. The crude peptide 17 (16.3 mg) was purified by RP-HPLC on a preparative Phenomenex Gemini C18, column at a flow rate of 5 mL min-1, using a linear gradient of 1percentB to 61percentB over 60 min (ca. 1percentB per minute) and lyophilised to give the title compound 17 as a white amorphous solid (4.9 mg, 18percent). Purified Lys-Pra-Asn-Thr-Ala-Thr-Ala(N3)-Ala-NH2 (17) (4.4 mg, 5.42 x 10-3 mmol) was dissolved in a mixture of water and tert-butyl alcohol (1 : 2.5, 3.5 mL in total). A stock solution of CuSO4 (0.87 mg, 5.42 x 10-3 mmol) and sodium ascorbate (2.68 mg, 13.6 x 10-3 mmol) in water (1.5 mL) was added and the mixture was microwaved for 20 min at 80 °C in a sealed reaction vessel (120 W max) to afford crude peptide (8), containing inseparable dehydroalanine by-product. The crude peptide (8) was purified by RP-HPLC on a preparative Waters XTerra.(R). Prep. C18 column at a flow rate of 10 mL/min, using a linear gradient of 1percentB to 51percentB over 50 min (ca. 1percentB per minute). Fractions were lyophilised to give the title compound 8 as a white amorphous solid (0.7 mg, 18percent), containing inseparable dehydroalanine by-product.

Reference： [1]Bioorganic and Medicinal Chemistry,2012,vol. 20,p. 2661 - 2668

12
[ 35661-39-3 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 198561-07-8 ]
[ 684270-46-0 ]
[ 1372190-74-3 ]

Yield	Reaction Conditions	Operation in experiment
		General procedure: Fmoc SPPS was performed on a Liberty Microwave Peptide Synthesiser (CEM Corporation, Mathews, NC) using the Fmoc/tBu strategy as previously described35 or manually starting from PAL-PEG polystyrene resin (0.21 mmol/g). For manual synthesis the following steps were undertaken: (a) Fmoc deprotection with 20percent piperidine for 5 min, then 15 min, washing with DMF 5.x.; (b) coupling of the Fmoc amino acid (5 equiv) in the presence of HBTU in DMF (4.9 equiv) and iPr2NEt (10 equiv) for 1 h and washing with DMF 5.x.. For coupling of Fmoc-Pra (1.5 equiv) and Fmoc-N3Ala (1.5 equiv), 1.45 equiv of HBTU and 4.5 equiv of iPr2NEt were used. The progress of the acylation step was monitored by the Kaiser test. A minimum amount of DMF was used for dissolution of the Fmoc amino acid. The resulting peptides were cleaved from the resin with simultaneous side chain protecting group removal by treatment with either TFA/iPr3SiH/DODT/H2O (v/v/v/v; 94/1/2.5/2.5), or with TFA/iPr3SiH/H2O (v/v/v; 95/2.5/2.5) for 2 h at room temperature. Crude peptides were precipitated and triturated with cold diethyl ether, isolated (centrifugation), dissolved in 20percent acetonitrile (aq) containing 0.1percent TFA and lyophilized. Analytical RP-HPLC was performed using a Dionex P680 (flow rate of 1 mL/min), or Dionex Ultimate U3000 system (flow rate of 0.5 mL/min or 0.2 mL/min) using Waters XTerra.(R). column (MS C18, 150 mm .x. 4.6 mm; 5 mum) or, Phenomenex Aqua column (C18, 250 mm .x. 4.6 mm; 5mu), or Phenomenex, Gemini column (C18, 50 mm .x. 2.0 mm, 5mu), using gradient systems as indicated in the Supplementary data. The solvent system used was A (0.1percent TFA in H2O) and B (0.1percent TFA in acetonitrile) with detection at 210 nm, 254 nm, and 280 nm****. The ratio of products was determined by integration of spectra recorded at 210 nm. Peptide masses were confirmed by an inline Thermo Finnegan MSQ mass spectrometer using ESI in the positive mode. When appropriate, a Bruker micrOTOF-Q II mass spectrometer was used for ESI-MS analysis (positive mode). Infrared spectra were obtained using a Perkin Elmer Spectrum One Fourier Transform infrared spectrometer with a universal ATR sampling accessory. Peptide purification was performed using a Waters 600E or Dionex Ultimate U3000 system using a Waters XTerra.(R). column (C18, 300 mm .x. 19 mm; 10 mum), or Phenomenex Gemini C18, 250 mm .x. 10 mm; 5 mum column. Gradient systems were adjusted according to the elution profiles and peak profiles obtained from the analytical RP-HPLC chromatograms. Fractions were collected, analysed by either RP-HPLC or ESI-MS, pooled and lyophilised three times from 10 mM aq HCl.

Reference： [1]Bioorganic and Medicinal Chemistry,2012,vol. 20,p. 2661 - 2668

13
[ 35661-39-3 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 198561-07-8 ]
[ 684270-46-0 ]
C₈₅H₁₁₆N₁₅O₁₇Pol [ No CAS ]

Yield	Reaction Conditions	Operation in experiment
		General procedure: Fmoc SPPS was performed on a Liberty Microwave Peptide Synthesiser (CEM Corporation, Mathews, NC) using the Fmoc/tBu strategy as previously described35 or manually starting from PAL-PEG polystyrene resin (0.21 mmol/g). For manual synthesis the following steps were undertaken: (a) Fmoc deprotection with 20percent piperidine for 5 min, then 15 min, washing with DMF 5.x.; (b) coupling of the Fmoc amino acid (5 equiv) in the presence of HBTU in DMF (4.9 equiv) and iPr2NEt (10 equiv) for 1 h and washing with DMF 5.x.. For coupling of Fmoc-Pra (1.5 equiv) and Fmoc-N3Ala (1.5 equiv), 1.45 equiv of HBTU and 4.5 equiv of iPr2NEt were used. The progress of the acylation step was monitored by the Kaiser test. A minimum amount of DMF was used for dissolution of the Fmoc amino acid. The resulting peptides were cleaved from the resin with simultaneous side chain protecting group removal by treatment with either TFA/iPr3SiH/DODT/H2O (v/v/v/v; 94/1/2.5/2.5), or with TFA/iPr3SiH/H2O (v/v/v; 95/2.5/2.5) for 2 h at room temperature. Crude peptides were precipitated and triturated with cold diethyl ether, isolated (centrifugation), dissolved in 20percent acetonitrile (aq) containing 0.1percent TFA and lyophilized. Analytical RP-HPLC was performed using a Dionex P680 (flow rate of 1 mL/min), or Dionex Ultimate U3000 system (flow rate of 0.5 mL/min or 0.2 mL/min) using Waters XTerra.(R). column (MS C18, 150 mm .x. 4.6 mm; 5 mum) or, Phenomenex Aqua column (C18, 250 mm .x. 4.6 mm; 5mu), or Phenomenex, Gemini column (C18, 50 mm .x. 2.0 mm, 5mu), using gradient systems as indicated in the Supplementary data. The solvent system used was A (0.1percent TFA in H2O) and B (0.1percent TFA in acetonitrile) with detection at 210 nm, 254 nm, and 280 nm****. The ratio of products was determined by integration of spectra recorded at 210 nm. Peptide masses were confirmed by an inline Thermo Finnegan MSQ mass spectrometer using ESI in the positive mode. When appropriate, a Bruker micrOTOF-Q II mass spectrometer was used for ESI-MS analysis (positive mode). Infrared spectra were obtained using a Perkin Elmer Spectrum One Fourier Transform infrared spectrometer with a universal ATR sampling accessory. Peptide purification was performed using a Waters 600E or Dionex Ultimate U3000 system using a Waters XTerra.(R). column (C18, 300 mm .x. 19 mm; 10 mum), or Phenomenex Gemini C18, 250 mm .x. 10 mm; 5 mum column. Gradient systems were adjusted according to the elution profiles and peak profiles obtained from the analytical RP-HPLC chromatograms. Fractions were collected, analysed by either RP-HPLC or ESI-MS, pooled and lyophilised three times from 10 mM aq HCl.

Reference： [1]Bioorganic and Medicinal Chemistry,2012,vol. 20,p. 2661 - 2668

14
Fmoc-Gly-Wang resin [ No CAS ]
[ 957780-52-8 ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-39-3 ]
[ 13734-38-8 ]
[ 71989-31-6 ]
[ 71989-18-9 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 86060-81-3 ]
Fmoc-Ala-Thr(Ψ^Me,Mepro)-OH [ No CAS ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 268209-75-2 ]
(Boc-Ser(tBu))-Lys(Boc)-Glu(OtBu)-Pro-Leu-Arg(pbf)-(S-(acetylaminomethyl)Cys)-Arg(pbf)-Pro-Ile-(O-(2-(isopropyl)phenyl)Asp)-Ala-(N,O-isopropylidene-Thr)-Leu-Ala-Val-Glu(OtBu)-Lys(Boc)-Glu(OtBu)-Gly-(S-(acetylaminomethyl)Cys)-Pro-Val-(S-(acetylaminomethyl)Cys)-Ile-(N,O-isopropylidene-Thr)-Val-(O-(2-(isopropyl)phenyl)Asp)-Thr(tBu)-Thr(tBu)-Ile-(S-(acetylaminomethyl)Cys)-Ala-Gly-OH [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2014,vol. 136,p. 8450 - 8458

15
Fmoc-Gly-Wang resin [ No CAS ]
[ 957780-52-8 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 13734-38-8 ]
[ 71989-31-6 ]
[ 71989-18-9 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 86060-81-3 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 268209-75-2 ]
Ser(Boc)-Arg(pbf)-Glu(OtBu)-Pro-Leu-Arg(pbf)-Pro-Trp(Boc)-(S-(acetylaminomethyl)Cys)-His(Trt)-Pro-Ile-Asn(Trt)-Ala-Ile-Leu-Ala-Val-Glu(OtBu)-Lys(Boc)-Glu(OtBu)-Gly-(S-(acetylaminomethyl)Cys)-Pro-Val-(S-(acetylaminomethyl)Cys)-Ile-(N,O-isopropylidene-Thr)-Val-(O-(2-(isopropyl)phenyl)Asp)-Thr(tBu)-Thr(tBu)-Ile-(S-(acetylaminomethyl)Cys)-Ala-Gly-OH [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2014,vol. 136,p. 8450 - 8458

16
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-39-3 ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 71989-18-9 ]
[ 35737-15-6 ]
[ 71989-35-0 ]
[ 71989-16-7 ]
[ 105047-45-8 ]
[ 77128-73-5 ]
[ 104090-92-8 ]
[ 1620146-28-2 ]

Reference： [1]Organic and Biomolecular Chemistry,2014,vol. 12,p. 5375 - 5381

17
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
DCLGA-(L-1-naphthylalanyl)-RKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH₂; disulfide linked (C2→C17, C9→C23, C16→C30) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 2299 - 2314

18
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 132388-59-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
[ 143824-78-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
DCLGF-(L-1-naphthylalanyl)-RKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH₂; disulfide linked (C2→C17, C9→C23, C16→C30) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 2299 - 2314

19
[ 35661-60-0 ]
C₂₃H₂₄N₂O₇ [ No CAS ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₉₉H₁₅₃N₁₆O₂₇Pol [ No CAS ]

Reference： [1]Journal of Peptide Science,2015,vol. 21,p. 231 - 235

20
[ 1360651-24-6 ]
C₂₃H₂₄N₂O₇ [ No CAS ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₉₈H₁₄₉N₁₈O₂₇Pol [ No CAS ]

Reference： [1]Journal of Peptide Science,2015,vol. 21,p. 231 - 235

21
[ 1026023-54-0 ]
[ 29022-11-5 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-18-9 ]
[ 556-08-1 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 109425-51-6 ]
[ 116821-47-7 ]
[ 198561-07-8 ]
[ 334918-39-7 ]
C₁₂₈H₂₁₈N₅₀O₃₆ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2015,vol. 13,p. 5273 - 5278

22
(2S)-4-[[1-(4,4-dimethyl-2,6-dioxocyclohexylidene)ethyl]amino]-2-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]butanoic acid [ No CAS ]
[ 929-10-2 ]
[ 35661-60-0 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
[ 688316-86-1 ]
6-methylheptanoyl-X-T-X-cyclo[X-X-DF-L-X-X-T] [ No CAS ]

Yield	Reaction Conditions	Operation in experiment
25%		General procedure: 2CTC resin (0.47g,loading = 0.53mmol/g ) was swelled in DCM/DMF for 20min before use. Then,Fmoc-Dab-OAll (1mmol, 4 eq), 8 eq. DIEA and 4ml DMF were added to react withresin for 12hr. The resin was capped with 200 mlmethanol to quench the remaining 2-chlorotrityl chloride. Generally, thesubsequent coupling was carried out using a solution of 4 eq. Fmoc-amino acid,3.8 eq. HCTU, and 8 eq. DIEA in DMF at 30 oC. Each coupling steprequired 1hr and the resin was washed by DMF and DCM before Fmoc-deprotection. The Fmoc group wasremoved by treatment with 20% piperidine in DMF twice (5 min, 10 min) followedby DMF and DCM wash. Dde group wasremoved by treatment with 3% NH2NH2/DMF for 20min threetimes. Allyl group wasremoved by treatment with PhSiH3 (10 eq.), Pd(PPh3)4(2 eq.) in 50% DCM/50% DMF for 3 hrs. After deprotection, the resin waswashed with DCM, 0.5% sodium diethyldithiocarbamate in DMF and DMF severaltimes. The finalcyclization step was carried out with 4 eq. PyAOP, 4eq. HOAt and 8eq.NMM for12hr. The cleavage reagentwas chose as TFA/water/TIPS (95/2.5/2.5). It was added into the dry resinprewashed with DCM and the cleavage was carried out for 1.5 hr. The TFAsolution was concentrated by blowing with N2. The crude peptideswere obtained by precipitating with cold diethyl ether, purified bysemi-preparative HPLC and lyophilized to achieve pure product.

Reference： [1]Tetrahedron Letters,2015,vol. 56,p. 4796 - 4799

23
(2S)-4-[[1-(4,4-dimethyl-2,6-dioxocyclohexylidene)ethyl]amino]-2-[[(9H-fluoren-9-ylmethoxy)carbonyl]amino]butanoic acid [ No CAS ]
[ 929-10-2 ]
[ 35661-60-0 ]
[ 71989-35-0 ]
[ 35661-60-0 ]
[ 125238-99-5 ]
[ 688316-86-1 ]
polymyxin E₂ [ No CAS ]

Yield	Reaction Conditions	Operation in experiment
25%		General procedure: 2CTC resin (0.47g,loading = 0.53mmol/g ) was swelled in DCM/DMF for 20min before use. Then,Fmoc-Dab-OAll (1mmol, 4 eq), 8 eq. DIEA and 4ml DMF were added to react withresin for 12hr. The resin was capped with 200 mlmethanol to quench the remaining 2-chlorotrityl chloride. Generally, thesubsequent coupling was carried out using a solution of 4 eq. Fmoc-amino acid,3.8 eq. HCTU, and 8 eq. DIEA in DMF at 30 oC. Each coupling steprequired 1hr and the resin was washed by DMF and DCM before Fmoc-deprotection. The Fmoc group wasremoved by treatment with 20% piperidine in DMF twice (5 min, 10 min) followedby DMF and DCM wash. Dde group wasremoved by treatment with 3% NH2NH2/DMF for 20min threetimes. Allyl group wasremoved by treatment with PhSiH3 (10 eq.), Pd(PPh3)4(2 eq.) in 50% DCM/50% DMF for 3 hrs. After deprotection, the resin waswashed with DCM, 0.5% sodium diethyldithiocarbamate in DMF and DMF severaltimes. The finalcyclization step was carried out with 4 eq. PyAOP, 4eq. HOAt and 8eq.NMM for12hr. The cleavage reagentwas chose as TFA/water/TIPS (95/2.5/2.5). It was added into the dry resinprewashed with DCM and the cleavage was carried out for 1.5 hr. The TFAsolution was concentrated by blowing with N2. The crude peptideswere obtained by precipitating with cold diethyl ether, purified bysemi-preparative HPLC and lyophilized to achieve pure product.

Reference： [1]Tetrahedron Letters,2015,vol. 56,p. 4796 - 4799

24
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
(1-naphthylalanine)SCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

25
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
R(1-naphthylalanine)CIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

26
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSC(1-naphthylalanine)DTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

27
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCI(1-naphthylalanine)TIPKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

28
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCID(1-naphthylalanine)IPKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

29
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDT(1-naphthylalanine)PKSRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

30
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIP(1-naphthylalanine)SRCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

31
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPK(1-naphthylalanine)RCTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

32
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKS(1-naphthylalanine)CTAFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

33
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRC(1-naphthylalanine)AFQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

34
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCT(1-naphthylalanine)FQCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

35
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTA(1-naphthylalanine)QCKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

36
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAF(1-naphthylalanine)CKHSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

37
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQC(1-naphthylalanine)HSMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

38
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCK(1-naphthylalanine)SMKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

39
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKH(1-naphthylalanine)MKYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

40
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKHS(1-naphthylalanine)KYRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

41
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKHSM(1-naphthylalanine)YRLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

42
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKHSMK(1-naphthylalanine)RLSFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

43
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKHSMKYR(1-naphthylalanine)SFCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

44
[ 29022-11-5 ]
[ 35661-60-0 ]
C₂₂H₂₀NOPolS [ No CAS ]
[ 112883-29-1 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-14-5 ]
[ 71989-23-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 71989-28-1 ]
[ 96402-49-2 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
RSCIDTIPKSRCTAFQCKHSMKYRL(1-naphthylalanine)FCRKTCGTC; disulfide linked (C3→35, C12→28, C17→32) [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2015,vol. 58,p. 6784 - 6802

45
N-α-(9-fluorenylmethoxycaebonyl)-N-γ-[1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl]-L-2,4-diaminobutyric acid [ No CAS ]
[ 220497-96-1 ]
Fmoc-Thr(OtBu)-O-Pol [ No CAS ]
Fmoc-Dap(dansyl)-OH [ No CAS ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₁₀₂H₁₆₃N₁₈O₂₇PolS [ No CAS ]

Reference： [1]Antimicrobial Agents and Chemotherapy,2015,vol. 59,p. 7489 - 7496

46
N-α-(9-fluorenylmethoxycaebonyl)-N-γ-[1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl]-L-2,4-diaminobutyric acid [ No CAS ]
[ 220497-96-1 ]
Fmoc-Thr(OtBu)-O-Pol [ No CAS ]
Fmoc-D-Dap(dansyl)-OH [ No CAS ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₉₉H₁₆₅N₁₈O₂₇PolS [ No CAS ]

Reference： [1]Antimicrobial Agents and Chemotherapy,2015,vol. 59,p. 7489 - 7496

47
N-α-(9-fluorenylmethoxycaebonyl)-N-γ-[1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl]-L-2,4-diaminobutyric acid [ No CAS ]
[ 220497-96-1 ]
Fmoc-Thr(OtBu)-O-Pol [ No CAS ]
[ 29022-11-5 ]
[ 35661-60-0 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₉₅H₁₆₀N₁₇O₂₆Pol [ No CAS ]

Reference： [1]Antimicrobial Agents and Chemotherapy,2015,vol. 59,p. 7489 - 7496

48
N-α-(9-fluorenylmethoxycaebonyl)-N-γ-[1-(4,4-dimethyl-2,6-dioxocyclohex-1-ylidene)-3-methylbutyl]-L-2,4-diaminobutyric acid [ No CAS ]
[ 220497-96-1 ]
Fmoc-Thr(OtBu)-O-Pol [ No CAS ]
[ 35661-60-0 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
C₁₀₃H₁₇₆N₁₇O₂₆Pol [ No CAS ]

Reference： [1]Antimicrobial Agents and Chemotherapy,2015,vol. 59,p. 7489 - 7496

49
C₅₇H₉₄N₁₁O₁₆Pol [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
[ 92-92-2 ]
C₆₀H₉₀N₁₆O₁₃ [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

50
[ 2215-77-2 ]
C₅₇H₉₄N₁₁O₁₆Pol [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
C₆₀H₉₀N₁₆O₁₄ [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

51
C₅₇H₉₄N₁₁O₁₆Pol [ No CAS ]
[ 92-95-5 ]
[ 71989-35-0 ]
[ 125238-99-5 ]
C₆₀H₉₁N₁₇O₁₃ [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

52
[ 124-07-2 ]
C₆₅H₁₀₄N₁₁O₁₆Pol [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
C₉₉H₁₆₅N₁₆O₂₅Pol [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

53
[ 124-07-2 ]
C₆₅H₁₀₄N₁₁O₁₆Pol [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
C₉₉H₁₆₅N₁₆O₂₅Pol [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

54
[ 124-07-2 ]
C₆₅H₁₀₄N₁₁O₁₆Pol [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
C₉₉H₁₆₅N₁₆O₂₅Pol [ No CAS ]

Reference： [1]Journal of Medicinal Chemistry,2016,vol. 59,p. 1068 - 1077

55
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
N⁴-(2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-β-D-glucopyranosyl)-N²-(9-fluorenylmethylcarbonyl)asparagine [ No CAS ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
KCNTATCATQRLANFLVHSS-(α-propargylglycinyl)-NFGPILPPTNVGS-(N⁴-(2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-β-D-glucopyranosyl)asparaginyl)-TY-NH₂ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2016,vol. 14,p. 5238 - 5245

56
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
N⁴-(2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-β-D-glucopyranosyl)-N²-(9-fluorenylmethylcarbonyl)asparagine [ No CAS ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
KCNTATCATQRLANFLVHSS-(N⁴-(2-acetamido-3,4,6-tri-O-acetyl-2-deoxy-β-D-glucopyranosyl)asparaginyl)-NFGPILPPTNVGS-(α-propargylglycinyl)-TY-NH₂ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2016,vol. 14,p. 5238 - 5245

57
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
K-CNTATCATQRLANFLVHSSNNFGPILPPTNVGS-(α-propargylglycinyl)-TY-NH₂ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2016,vol. 14,p. 5238 - 5245

58
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
K-CNTATCATQRLANFLVHSS-(α-propargylglycinyl)-NFGPILPPTNVGS-(α-propargylglycinyl)-TY-NH₂ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2016,vol. 14,p. 5238 - 5245

59
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-33-8 ]
[ 71989-23-6 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 103213-32-7 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 132327-80-1 ]
[ 109425-51-6 ]
Nα-(9-fluorenylmethyloxycarbonyl)-Nγ-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl-L-arginine [ No CAS ]
[ 198561-07-8 ]
KCNTATCATQRLANFLVHSS-(α-propargylglycinyl)-NFGPILPPTNVGSNTY-NH₂ [ No CAS ]

Reference： [1]Organic and Biomolecular Chemistry,2016,vol. 14,p. 5238 - 5245

60
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-60-0 ]
[ 35661-39-3 ]
[ 71195-85-2 ]
[ 71989-31-6 ]
[ 35661-40-6 ]
[ 71989-38-3 ]
[ 71989-35-0 ]
acryloyl-Ala-Phe-Leu-Pro-Ala-Thr(tBu)-Val-Tyr(tBu)-Leu-Gly [ No CAS ]

Reference： [1]Angewandte Chemie - International Edition,2017,vol. 56,p. 728 - 732
Angew. Chem.,2017,vol. 129,p. 746 - 750,5

61
[ 3025-96-5 ]
[ 29022-11-5 ]
[ 71195-85-2 ]
[ 35661-40-6 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
1-tert-butoxycarbonyl-N-[(9-fluorenyl)methoxycarbonyl]-D-tryptophan [ No CAS ]
[ 143824-78-6 ]
[ 188112-22-3 ]
acryloyl-Phe-Trp(Boc)-(D)Trp(Boc)-Lys(Boc)-Thr(tBu)-Phe-(4-acetamide)Aba-Gly [ No CAS ]

Reference： [1]Angewandte Chemie - International Edition,2017,vol. 56,p. 728 - 732
Angew. Chem.,2017,vol. 129,p. 746 - 750,5

62
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 71195-85-2 ]
[ 35661-40-6 ]
[ 71989-35-0 ]
[ 143824-78-6 ]
acryloyl-Val-Thr(tBu)-Phe-Trp(Boc)-Gly [ No CAS ]

Reference： [1]Angewandte Chemie - International Edition,2017,vol. 56,p. 728 - 732
Angew. Chem.,2017,vol. 129,p. 746 - 750,5

63
[ 252049-08-4 ]
[ 124-07-2 ]
[ 35661-60-0 ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
[ 198561-07-8 ]
C₈₈H₁₁₉N₁₅O₂₂ [ No CAS ]

Reference： [1]ACS Infectious Diseases,2017,vol. 3,p. 941 - 954

64
C₈₅H₁₄₇N₂₀O₁₇PolS₂ [ No CAS ]
[ 71989-35-0 ]
[ 125238-99-5 ]
[ 76-05-1 ]
C₈₆H₁₆₈N₃₂O₂₁*11C₂HF₃O₂ [ No CAS ]

Reference： [1]Journal of the American Chemical Society,2018,vol. 140,p. 423 - 432

65
[ 4530-20-5 ]
[ 29022-11-5 ]
[ 68858-20-8 ]
[ 35661-39-3 ]
[ 71989-31-6 ]
[ 71989-18-9 ]
[ 71989-38-3 ]
[ 71989-26-9 ]
[ 71989-35-0 ]
[ 132388-59-1 ]
[ 77128-73-5 ]
[ 143824-78-6 ]
[ 1620146-28-2 ]

Yield	Reaction Conditions	Operation in experiment
21%		General procedure: Solid-phase peptide synthesis was carried out on Fmoc-cappedpolystyrene rink amide MBHA resin (100-200 mesh, 0.05-0.15 mmol scale). The following amino acidderivatives suitable for Fmoc SPPS were used: Fmoc-Cys(Trt)-OH, Fmoc-Gly-OH, Fmoc-Glu(tBu)-OH,Fmoc-Trp(Boc)-OH, Fmoc-Ala-OH, Fmoc-Tyr(tBu)-OH, Fmoc-Asn(Trt)-OH, Fmoc-Pro-OH, Fmoc-Thr(tBu)-OH, Fmoc-Lys(Boc)-OH, Fmoc-Phe-OH, Fmoc-Val-OH, Fmoc-aPhe-OH, Fmoc-aVal-OH,Fmoc-aTyr(tBu)-OH, Fmoc-(N-Me)-Phe-OH, Fmoc-D-Ser(TBS)-OH, Fmoc-D-hSer(TBS)-OH, Boc-Gly-OH. Dry resin was washed with DMF 3x and allowed to swell in DMF for 2 h prior to use. Allreactions were carried out using gentle agitation. Fmoc deprotection steps were carried out by treating theresin with a solution of 20percent piperidine/DMF (15 min x 2). Coupling of Fmoc-protected amino acids aswell as (N2-Boc)-hydrazino acids was effected using 5 equiv. HATU (0.5 M in DMF), 10 equiv. DIEA(1.0 M in DMF), and 5 equiv. of the carboxylic acid in DMF at 50 oC (1 h). Coupling of residues Nterminalto the hydrazino acids was carried out with 30 equiv. collidine and 10 equiv. of pre-formed Fmocamino acid chlorides (or 10 equiv. of Fmoc amino acids with 3.3 equiv. triphosgene) in THF at rt (1 h x2).3 After each reaction the resin was washed with DMF 2x, DCM 1x, then DMF 1x. Peptides undergoingMitsunobu reactions were capped with Boc-Gly-OH, washed with DCM 3x, and treated with 5 equiv.TBAF in THF for 3 h at rt. After the reaction the resin was washed with DCM 3x and then treated with 5equiv. triphenylphosphine in THF followed by 5 equiv. of DIAD, then strirred overnight at rt. Peptideswere cleaved from the resin by incubating with gentle stirring in 2 mL of 95:5 TFA:H2O at rt for 2 h. Thecleavage mixture was filtered and the resin was rinsed with an additional 1 mL of cleavage solution. Thefiltrate was treated with 8 mL of cold Et2O to induce precipitation. The mixture was centrifuged and thesupernatant was removed. The remaining solid was washed 2 more times with Et2O and dried undervacuum. Cysteine-containing peptides were purified, lyophilized, dissolved in 10mM phosphate buffer(pH 8.9, 5percent v/v DMSO), stirred until analytical HPLC and MS showed complete conversion to the cyclicdisulfide (1-2 d), and then repurified. Peptides were analyzed and purified on C12 RP-HPLC columns(preparative: 4mu, 90A, 250 x 21.2 mm; analytical: 4mu, 90A, 150 x 4.6 mm) using linear gradients ofMeCN/H2O (with 0.1percent formic acid), then lyophilized to afford white powders. All peptides werecharacterized by LCMS (ESI), HRMS (ESI-TOF), and 1H NMR. Analytical HPLC samples for all purifiedpeptides were prepared as 1 mM in H2O containing 20 mM phosphate buffer at pH 7.0. Linear gradientsof MeCN in H2O (0.1percent formic acid) were run over 20 minutes and spectra are provided for lambda = 220 nm.

Reference： [1]Bioorganic and Medicinal Chemistry,2018,vol. 26,p. 1162 - 1166

66
[ 504-99-4 ]
Fmoc-L-Dab(Dde)-OH, DDE = 1-(4,4-dimethyl-2,6-dioxocylohexylidene)ethyl [ No CAS ]
[ 71989-35-0 ]
[ 86123-10-6 ]
[ 125238-99-5 ]
[ 76-05-1 ]
[ 688316-86-1 ]
Fmoc-D-Ser(pg)-OH [ No CAS ]
polymyxin S₁ TFA salt [ No CAS ]